Recombinant Human MMP13 protein, His-SUMO-tagged
Cat.No. : | MMP13-3231H |
Product Overview : | Recombinant Human MMP13 protein(P45452)(104-471aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 104-471aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.3 kDa |
AA Sequence : | YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | MMP13 matrix metallopeptidase 13 (collagenase 3) [ Homo sapiens ] |
Official Symbol | MMP13 |
Synonyms | MMP13; matrix metallopeptidase 13 (collagenase 3); matrix metalloproteinase 13 (collagenase 3); collagenase 3; CLG3; MMP-13; MANDP1; |
Gene ID | 4322 |
mRNA Refseq | NM_002427 |
Protein Refseq | NP_002418 |
MIM | 600108 |
UniProt ID | P45452 |
◆ Recombinant Proteins | ||
MMP13-2448H | Recombinant Human MMP13 Protein, His-tagged | +Inquiry |
Mmp13-734R | Recombinant Rat Mmp13 protein, His-tagged | +Inquiry |
MMP13-411H | Recombinant Human Matrix Metallopeptidase 13 (collagenase 3) | +Inquiry |
MMP13-92H | Recombinant Human MMP13 protein, T7/His-tagged | +Inquiry |
MMP13-0833H | Recombinant Human MMP13 Protein (E103-N274), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MMP13 Products
Required fields are marked with *
My Review for All MMP13 Products
Required fields are marked with *
0
Inquiry Basket