Recombinant Human MMP2 protein, GST-tagged
Cat.No. : | MMP2-1872H |
Product Overview : | Recombinant Human MMP2 protein(110-200 aa), fused to GST tag, was expressed in E. coli. |
Availability | August 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 110-200 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MMP2 matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) [ Homo sapiens ] |
Official Symbol | MMP2 |
Synonyms | MMP2; matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); CLG4, CLG4A, matrix metalloproteinase 2 (gelatinase A, 72kD gelatinase, 72kD type IV collagenase) , matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); 72 kDa type IV collagenase; TBE 1; MMP-2; gelatinase A; 72 kDa gelatinase; collagenase type IV-A; neutrophil gelatinase; matrix metalloproteinase-2; matrix metalloproteinase-II; CLG4; MONA; CLG4A; TBE-1; MMP-II; |
Gene ID | 4313 |
mRNA Refseq | NM_001127891 |
Protein Refseq | NP_001121363 |
MIM | 120360 |
UniProt ID | P08253 |
◆ Recombinant Proteins | ||
Mmp2-1783M | Recombinant Mouse Mmp2 Protein, His-tagged | +Inquiry |
Mmp2-10593M | Recombinant Mouse Mmp2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP2-657R | Recombinant Rat MMP2 Protein (110-662 aa), His-SUMO-tagged | +Inquiry |
MMP2-8392HA | Recombinant Human MMP2 protein, GST-tagged, APC labeled | +Inquiry |
MMP2-0391M | Active Recombinant Mouse MMP2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-29475TH | Native Human MMP2 | +Inquiry |
MMP2-47H | Native Human MMP-2/TIMP-2 Complex | +Inquiry |
MMP2-46H | Native Human MMP-2 | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP2-2380HCL | Recombinant Human MMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP2 Products
Required fields are marked with *
My Review for All MMP2 Products
Required fields are marked with *