Recombinant Human MMS19 Protein, GST-tagged

Cat.No. : MMS19-5441H
Product Overview : Human MMS19L full-length ORF ( AAH07298, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MMS19 (MMS19 Homolog, Cytosolic Iron-Sulfur Assembly Component) is a Protein Coding gene. Among its related pathways are Cytosolic iron-sulfur cluster assembly and Metabolism. GO annotations related to this gene include binding and protein binding, bridging.
Molecular Mass : 57.97 kDa
AA Sequence : MRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPPDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKSLDDKKRLVRKEAVSARGEWFLLGSPGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MMS19 MMS19 nucleotide excision repair homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol MMS19
Synonyms MMS19; MMS19 nucleotide excision repair homolog (S. cerevisiae); MMS19L; MMS19 nucleotide excision repair protein homolog; hMMS19; MET18; MET18 homolog (S. cerevisiae); MET18 homolog; MMS19-like protein; homolog of yeast MMS19; MMS19-like (MET18 homolog, S. cerevisiae); FLJ34167; FLJ95146; MGC99604;
Gene ID 64210
mRNA Refseq NM_022362
Protein Refseq NP_071757
UniProt ID Q96T76

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MMS19 Products

Required fields are marked with *

My Review for All MMS19 Products

Required fields are marked with *

0
cart-icon
0
compare icon