"MPO" Related Products

Expand
Expand

Recombinant Human MPO protein, His-tagged

Cat.No.: MPO-49H
Product Overview: Recombinant Human MPO fused with His tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: lyophilized from a 0.2um filtered solution in PBS, pH 7.4 with 5% trehalose and 0.01% thimerosal
Molecular Mass: 65.8kD
AA Sequence: MKKGHHHHHHLVPRGSCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPN DPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNG RALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEAR KIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEP NPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHG LPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQF RKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWRE AS
Purity: Greater than 95% by SDS-PAGE gel analyses.
Applications: Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies.
Storage: - 20°C for Lyophilized, - 80°C for Liquid
Gene Name: MPO myeloperoxidase [ Homo sapiens ]
Official Symbol: MPO
Synonyms: MPO; myeloperoxidase;
Gene ID: 4353
mRNA Refseq: NM_000250
Protein Refseq: NP_000241
MIM: 606989
UniProt ID: P05164
Chromosome Location: 17q21.3-q23
Pathway: C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem;
Function: chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.