Recombinant Human MPO protein, His-tagged
Cat.No. : | MPO-49H |
Product Overview : | Recombinant Human MPO fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Form : | lyophilized from a 0.2um filtered solution in PBS, pH 7.4 with 5% trehalose and 0.01% thimerosal |
Molecular Mass : | 65.8kD |
AA Sequence : | MKKGHHHHHHLVPRGSCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPN DPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNG RALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEAR KIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEP NPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHG LPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQF RKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWRE AS |
Purity : | Greater than 95% by SDS-PAGE gel analyses. |
Applications : | Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies. |
Storage : | - 20°C for Lyophilized, - 80°C for Liquid |
Gene Name | MPO myeloperoxidase [ Homo sapiens ] |
Official Symbol | MPO |
Synonyms | MPO; myeloperoxidase; |
Gene ID | 4353 |
mRNA Refseq | NM_000250 |
Protein Refseq | NP_000241 |
MIM | 606989 |
UniProt ID | P05164 |
Chromosome Location | 17q21.3-q23 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; |
Function | chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity; |
◆ Recombinant Proteins | ||
Mpo-52M | Recombinant Mouse Mpo Protein, His-tagged | +Inquiry |
MPO-51H | Recombinant Human MPO Protein, His-tagged | +Inquiry |
Mpo-5650M | Recombinant Mouse Mpo Protein, His (Fc)-Avi-tagged | +Inquiry |
Mpo-2639R | Recombinant Rat Mpo protein, His & T7-tagged | +Inquiry |
Mpo-1790R | Recombinant Rat Mpo Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
MPO-01H | Active Native Human MPO Protein | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPO-4234HCL | Recombinant Human MPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPO Products
Required fields are marked with *
My Review for All MPO Products
Required fields are marked with *
0
Inquiry Basket