Recombinant Human MPO protein, His-tagged
| Cat.No. : | MPO-49H |
| Product Overview : | Recombinant Human MPO fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Form : | lyophilized from a 0.2um filtered solution in PBS, pH 7.4 with 5% trehalose and 0.01% thimerosal |
| Molecular Mass : | 65.8kD |
| AA Sequence : | MKKGHHHHHHLVPRGSCPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPN DPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNG RALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEAR KIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEP NPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHG LPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQF RKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWRE AS |
| Purity : | Greater than 95% by SDS-PAGE gel analyses. |
| Applications : | Immunogen for antibody production, immunological and mass myoglobin standard, myoglobin biochemical and immunochemical studies. |
| Storage : | - 20°C for Lyophilized, - 80°C for Liquid |
| Gene Name | MPO myeloperoxidase [ Homo sapiens ] |
| Official Symbol | MPO |
| Synonyms | MPO; myeloperoxidase; |
| Gene ID | 4353 |
| mRNA Refseq | NM_000250 |
| Protein Refseq | NP_000241 |
| MIM | 606989 |
| UniProt ID | P05164 |
| Chromosome Location | 17q21.3-q23 |
| Pathway | C-MYB transcription factor network, organism-specific biosystem; Folate Metabolism, organism-specific biosystem; IL23-mediated signaling events, organism-specific biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; Selenium Pathway, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; |
| Function | chromatin binding; heme binding; heparin binding; metal ion binding; oxidoreductase activity; peroxidase activity; |
| ◆ Recombinant Proteins | ||
| MPO-51H | Recombinant Human MPO Protein, His-tagged | +Inquiry |
| MPO-493H | Recombinant Human MPO protein, His-tagged | +Inquiry |
| Mpo-418M | Active Recombinant Mouse Mpo, His-tagged | +Inquiry |
| MPO-5506H | Recombinant Human MPO Protein, GST-tagged | +Inquiry |
| Mpo-1790R | Recombinant Rat Mpo Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MPO -27H | Active Native Human Myeloperoxidase | +Inquiry |
| MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
| MPO-01H | Active Native Human MPO Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPO-4234HCL | Recombinant Human MPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPO Products
Required fields are marked with *
My Review for All MPO Products
Required fields are marked with *
