"MPZ" Related Products

Expand

Recombinant Human MPZ protein, His-tagged

Cat.No.: MPZ-8493H
Product Overview: Recombinant Human MPZ(Ile30-Arg153) fused with His tag at C-terminal was expressed in HEK293.
Description: Myelin Protein P0 (MPZ) is a single-pass type I membrane glycoprotein which belongs to the myelin P0 protein family. MPZ contains one Ig-like V-type (immunoglobulin-like) domain, absent in the central nervous system. MPZ is a major component of the myelin sheath in peripheral nerves. It is postulated that MPZ is a structural element in the formation and stabilisation of peripheral nerve myelin, holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular of adjacent extracellular domains. Defects in MPZ associated with Charcot-Marie-Tooth disease and Dejerine-Sottas disease.
Source: HEK293
Species: Human
Tag : His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Protein length: Ile30-Arg153
AA Sequence: IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGT FKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHH HH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: MPZ myelin protein zero [ Homo sapiens ]
Official Symbol: MPZ
Synonyms: MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; myelin peripheral protein; Charcot-Marie-Tooth neuropathy 1B; P0; CHM; DSS; MPP; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3;
Gene ID: 4359
mRNA Refseq: NM_000530
Protein Refseq: NP_000521
MIM: 159440
UniProt ID: P25189
Chromosome Location: 1q22
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function: structural molecule activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.