Recombinant Human MPZ protein, His-tagged
| Cat.No. : | MPZ-8493H |
| Product Overview : | Recombinant Human MPZ(Ile30-Arg153) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Ile30-Arg153 |
| Description : | Myelin Protein P0 (MPZ) is a single-pass type I membrane glycoprotein which belongs to the myelin P0 protein family. MPZ contains one Ig-like V-type (immunoglobulin-like) domain, absent in the central nervous system. MPZ is a major component of the myelin sheath in peripheral nerves. It is postulated that MPZ is a structural element in the formation and stabilisation of peripheral nerve myelin, holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular of adjacent extracellular domains. Defects in MPZ associated with Charcot-Marie-Tooth disease and Dejerine-Sottas disease. |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| AA Sequence : | IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGT FKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHH HH |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Gene Name | MPZ myelin protein zero [ Homo sapiens ] |
| Official Symbol | MPZ |
| Synonyms | MPZ; myelin protein zero; Charcot Marie Tooth neuropathy 1B , CMT1, CMT1B; myelin protein P0; HMSNIB; myelin peripheral protein; Charcot-Marie-Tooth neuropathy 1B; P0; CHM; DSS; MPP; CMT1; CMT1B; CMT2I; CMT2J; CMT4E; CMTDI3; |
| Gene ID | 4359 |
| mRNA Refseq | NM_000530 |
| Protein Refseq | NP_000521 |
| MIM | 159440 |
| UniProt ID | P25189 |
| Chromosome Location | 1q22 |
| Pathway | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; |
| Function | structural molecule activity; |
| ◆ Recombinant Proteins | ||
| Mpz-1791R | Recombinant Rat Mpz Protein, His&GST-tagged | +Inquiry |
| Mpz-4131M | Recombinant Mouse Mpz Protein, Myc/DDK-tagged | +Inquiry |
| RFL29226MF | Recombinant Full Length Mouse Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
| RFL31068BF | Recombinant Full Length Bovine Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
| MPZ-3239H | Recombinant Human MPZ protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *
