Recombinant Full Length Bovine Myelin Protein P0(Mpz) Protein, His-Tagged
Cat.No. : | RFL31068BF |
Product Overview : | Recombinant Full Length Bovine Myelin protein P0(MPZ) Protein (P10522) (29-248aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-248) |
Form : | Lyophilized powder |
AA Sequence : | AIVVYTDKEVHGAVGSQVTLYCSFWSSEWVSDDLSFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPHRKDGSIVIHNLDYGDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLALLLFYLIRYCWLRRQAALQRRLSAMEKGKLHKTAKDASKRGRQTPVLYAMLDHSRSTKAASEKKTKGLGESRKDKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MPZ |
Synonyms | MPZ; Myelin protein P0; Myelin peripheral protein; MPP; Myelin protein zero |
UniProt ID | P10522 |
◆ Recombinant Proteins | ||
MPZ-3902H | Recombinant Human MPZ protein, MYC/DDK-tagged | +Inquiry |
RFL31068BF | Recombinant Full Length Bovine Myelin Protein P0(Mpz) Protein, His-Tagged | +Inquiry |
MPZ-4600H | Recombinant Human MPZ Protein (Ile30-Lys248), His tagged | +Inquiry |
MPZ-314HF | Recombinant Full Length Human MPZ Protein | +Inquiry |
MPZ-1461H | Recombinant Human MPZ Protein (30-156 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MPZ-4219HCL | Recombinant Human MPZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPZ Products
Required fields are marked with *
My Review for All MPZ Products
Required fields are marked with *
0
Inquiry Basket