Recombinant Human MRC1 Protein, GST-tagged

Cat.No. : MRC1-5534H
Product Overview : Human MRC1 partial ORF ( NP_002429, 22 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment. This gene is in close proximity to MRC1L1. The gene loci including this gene, MRC1L1, as well as LOC340843 and LOC340893, consist of two nearly identical, tandemly linked genomic regions, which are thought to be a part of a duplicated region. [provided by RefSeq
Molecular Mass : 37.73 kDa
AA Sequence : TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRC1 mannose receptor, C type 1 [ Homo sapiens ]
Official Symbol MRC1
Synonyms MRC1; mannose receptor, C type 1; mannose receptor, C type 1 like 1 , MRC1L1; macrophage mannose receptor 1; bA541I19.1; CD206; CLEC13D; CLEC13DL; mannose receptor, C type 1-like 1; C-type lectin domain family 13 member D; macrophage mannose receptor 1-like protein 1; MMR; MRC1L1; MGC181940;
Gene ID 4360
mRNA Refseq NM_002438
Protein Refseq NP_002429
MIM 153618
UniProt ID P22897

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRC1 Products

Required fields are marked with *

My Review for All MRC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon