Recombinant Human MRC1 Protein, GST-tagged
Cat.No. : | MRC1-5534H |
Product Overview : | Human MRC1 partial ORF ( NP_002429, 22 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment. This gene is in close proximity to MRC1L1. The gene loci including this gene, MRC1L1, as well as LOC340843 and LOC340893, consist of two nearly identical, tandemly linked genomic regions, which are thought to be a part of a duplicated region. [provided by RefSeq |
Molecular Mass : | 37.73 kDa |
AA Sequence : | TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRC1 mannose receptor, C type 1 [ Homo sapiens ] |
Official Symbol | MRC1 |
Synonyms | MRC1; mannose receptor, C type 1; mannose receptor, C type 1 like 1 , MRC1L1; macrophage mannose receptor 1; bA541I19.1; CD206; CLEC13D; CLEC13DL; mannose receptor, C type 1-like 1; C-type lectin domain family 13 member D; macrophage mannose receptor 1-like protein 1; MMR; MRC1L1; MGC181940; |
Gene ID | 4360 |
mRNA Refseq | NM_002438 |
Protein Refseq | NP_002429 |
MIM | 153618 |
UniProt ID | P22897 |
◆ Recombinant Proteins | ||
MRC1-3240H | Recombinant Human MRC1 protein, His-tagged | +Inquiry |
MRC1-30H | Recombinant Human MRC1 protein, His-tagged | +Inquiry |
MRC1-30HB | Recombinant Human MRC1 protein, His-tagged, Biotinylated | +Inquiry |
Mrc1-677R | Active Recombinant Rat Mrc1, His-tagged | +Inquiry |
Mrc1-3405R | Recombinant Rat Mrc1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRC1-4212HCL | Recombinant Human MRC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRC1 Products
Required fields are marked with *
My Review for All MRC1 Products
Required fields are marked with *
0
Inquiry Basket