Recombinant Human MRPL12, His-tagged

• Cat.No.: MRPL12-144H
• Product Overview: Recombinant Human 39S Ribosomal Protein L12 Mitochondrial/MRPL12 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu46-Glu198) of Human MRPL12 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 46-198 a.a.
• AA Sequence: EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPA AAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKAN VAKAEAEKIKAALEAVGGTVVLEVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: MRPL12 mitochondrial ribosomal protein L12 [ Homo sapiens ]
• Official Symbol: MRPL12
• Synonyms: MRPL12; mitochondrial ribosomal protein L12; RPML12; 39S ribosomal protein L12, mitochondrial; MRPL7; MRPL7/L12; MRP-L12; 5c5-2; L12mt; MRP-L31/34; MGC8610; FLJ60124
• Gene ID: 6182
• mRNA Refseq: NM_002949
• Protein Refseq: NP_002940
• MIM: 602375
• UniProt ID: P52815
• Chromosome Location: 17q25
• Function: RNA binding; protein binding; structural constituent of ribosome