Recombinant Human MRPL12, His-tagged

Cat.No. : MRPL12-144H
Product Overview : Recombinant Human 39S Ribosomal Protein L12 Mitochondrial/MRPL12 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu46-Glu198) of Human MRPL12 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 46-198 a.a.
AA Sequence : EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPA AAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKAN VAKAEAEKIKAALEAVGGTVVLEVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name MRPL12 mitochondrial ribosomal protein L12 [ Homo sapiens ]
Official Symbol MRPL12
Synonyms MRPL12; mitochondrial ribosomal protein L12; RPML12; 39S ribosomal protein L12, mitochondrial; MRPL7; MRPL7/L12; MRP-L12; 5c5-2; L12mt; MRP-L31/34; MGC8610; FLJ60124;
Gene ID 6182
mRNA Refseq NM_002949
Protein Refseq NP_002940
MIM 602375
UniProt ID P52815
Chromosome Location 17q25
Function RNA binding; protein binding; structural constituent of ribosome;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPL12 Products

Required fields are marked with *

My Review for All MRPL12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon