Recombinant Human MRPL12 Protein (1-198 aa), GST-tagged

• Cat.No.: MRPL12-2155H
• Product Overview: Recombinant Human MRPL12 Protein (1-198 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-198 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 43.4 kDa
• AA Sequence: EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: MRPL12 mitochondrial ribosomal protein L12 [ Homo sapiens ]
• Official Symbol: MRPL12
• Synonyms: MRPL12; RPML12; MRPL7; MRPL7/L12; MRP-L12; 5c5-2; L12mt; MRP-L31/34; MGC8610; FLJ60124
• Gene ID: 6182
• mRNA Refseq: NM_002949
• Protein Refseq: NP_002940
• MIM: 602375
• UniProt ID: P52815