Recombinant Human MRS2 Protein, GST-tagged

Cat.No. : MRS2-5630H
Product Overview : Human MRS2L full-length ORF ( AAH01028, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MRS2 (MRS2, Magnesium Transporter) is a Protein Coding gene. Diseases associated with MRS2 include Basilar Artery Occlusion. Among its related pathways are Miscellaneous transport and binding events and Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds. GO annotations related to this gene include magnesium ion transmembrane transporter activity.
Molecular Mass : 38.61 kDa
AA Sequence : MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRS2 MRS2 magnesium homeostasis factor homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol MRS2
Synonyms MRS2; MRS2 magnesium homeostasis factor homolog (S. cerevisiae); MRS2 like, magnesium homeostasis factor (S. cerevisiae) , MRS2L; magnesium transporter MRS2 homolog, mitochondrial; MRS2-like protein; MRS2-like, magnesium homeostasis factor; HPT; MRS2L; MGC78523;
Gene ID 57380
mRNA Refseq NM_020662
Protein Refseq NP_065713
UniProt ID Q9HD23

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRS2 Products

Required fields are marked with *

My Review for All MRS2 Products

Required fields are marked with *

0
cart-icon