Recombinant Human MS4A15 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : MS4A15-161H
Product Overview : MS4A15 MS Standard C13 and N15-labeled recombinant protein (NP_689930) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : May be involved in signal transduction as a component of a multimeric receptor complex.
Molecular Mass : 15.4 kDa
AA Sequence : MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MS4A15 membrane spanning 4-domains A15 [ Homo sapiens (human) ]
Official Symbol MS4A15
Synonyms MS4A15; membrane spanning 4-domains A15; FLJ34527; MGC35295; membrane-spanning 4-domains subfamily A member 15
Gene ID 219995
mRNA Refseq NM_152717
Protein Refseq NP_689930
UniProt ID Q8N5U1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A15 Products

Required fields are marked with *

My Review for All MS4A15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon