Recombinant Human MS4A15 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | MS4A15-161H |
Product Overview : | MS4A15 MS Standard C13 and N15-labeled recombinant protein (NP_689930) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | May be involved in signal transduction as a component of a multimeric receptor complex. |
Molecular Mass : | 15.4 kDa |
AA Sequence : | MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGVTNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNVAYAQGVVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MS4A15 membrane spanning 4-domains A15 [ Homo sapiens (human) ] |
Official Symbol | MS4A15 |
Synonyms | MS4A15; membrane spanning 4-domains A15; FLJ34527; MGC35295; membrane-spanning 4-domains subfamily A member 15 |
Gene ID | 219995 |
mRNA Refseq | NM_152717 |
Protein Refseq | NP_689930 |
UniProt ID | Q8N5U1 |
◆ Recombinant Proteins | ||
RFL5574HF | Recombinant Full Length Human Membrane-Spanning 4-Domains Subfamily A Member 15(Ms4A15) Protein, His-Tagged | +Inquiry |
MS4A15-161H | Recombinant Human MS4A15 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MS4A15-10116M | Recombinant Mouse MS4A15 Protein | +Inquiry |
MS4A15-6403HF | Recombinant Full Length Human MS4A15 Protein, GST-tagged | +Inquiry |
MS4A15-5734M | Recombinant Mouse MS4A15 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A15-4127HCL | Recombinant Human MS4A15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A15 Products
Required fields are marked with *
My Review for All MS4A15 Products
Required fields are marked with *