Recombinant Human MT1F Protein (1-59 aa), His-tagged

• Cat.No.: MT1F-1463H
• Product Overview: Recombinant Human MT1F Protein (1-59 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-59 aa
• Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 7.9 kDa
• AA Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSC
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: MT1F metallothionein 1F [ Homo sapiens (human) ]
• Official Symbol: MT1F
• Synonyms: MT1
• Gene ID: 4494
• mRNA Refseq: NM_001301272
• Protein Refseq: NP_001288201
• UniProt ID: P04733