Recombinant Human MT2A Protein (1-59 aa), His-tagged
Cat.No. : | MT2A-1464H |
Product Overview : | Recombinant Human MT2A Protein (1-59 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-59 aa |
Description : | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 7.9 kDa |
AA Sequence : | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | MT2A metallothionein 2A [ Homo sapiens ] |
Official Symbol | MT2A |
Synonyms | MT2A; metallothionein 2A; MT2; MT-2; MT-II; |
Gene ID | 4502 |
mRNA Refseq | NM_005953 |
Protein Refseq | NP_005944 |
MIM | 156360 |
UniProt ID | P02795 |
◆ Recombinant Proteins | ||
MT2A-6999HF | Recombinant Full Length Human MT2A Protein, GST-tagged | +Inquiry |
MT2A-2708R | Recombinant Rhesus Macaque MT2A Protein, His (Fc)-Avi-tagged | +Inquiry |
MT2A-1071H | Recombinant Human MT2A, GST-tagged | +Inquiry |
MT2A-130H | Recombinant Human MT2A, GST-tagged | +Inquiry |
MT2A-1464H | Recombinant Human MT2A Protein (1-59 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT2A-4096HCL | Recombinant Human MT2A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MT2A Products
Required fields are marked with *
My Review for All MT2A Products
Required fields are marked with *