Recombinant Human MT2A Protein (1-59 aa), His-tagged

Cat.No. : MT2A-1464H
Product Overview : Recombinant Human MT2A Protein (1-59 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-59 aa
Description : Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 7.9 kDa
AA Sequence : MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name MT2A metallothionein 2A [ Homo sapiens ]
Official Symbol MT2A
Synonyms MT2A; metallothionein 2A; MT2; MT-2; MT-II;
Gene ID 4502
mRNA Refseq NM_005953
Protein Refseq NP_005944
MIM 156360
UniProt ID P02795

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MT2A Products

Required fields are marked with *

My Review for All MT2A Products

Required fields are marked with *

0
cart-icon
0
compare icon