Recombinant Human MTHFD2, GST-tagged
Cat.No. : | MTHFD2-395H |
Product Overview : | Recombinant Human MTHFD2 (16 a.a. - 344 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in two different transcripts, one protein-coding and the other not protein-coding. This gene has a pseudogene on chromosome 7. |
Molecular Mass : | 61.93 kDa |
AA Sequence : | SLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVG INSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYS MLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTIL ADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLM KNTIIAAKKVLRLEEREVLKSKELGVATN |
Applications : | ELSA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ] |
Official Symbol | MTHFD2 |
Synonyms | MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; NMDMC; methylenetetrahydrofolate dehydrogenase 2; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase methylene tetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase; EC 1.5.1.15 |
Gene ID | 10797 |
mRNA Refseq | NM_006636 |
Protein Refseq | NP_006627 |
MIM | 604887 |
UniProt ID | P13995 |
Chromosome Location | 2p13.1 |
Pathway | C1-unit interconversion; Nucleotide Metabolism; One carbon pool by folate; tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate |
Function | NOT formate-tetrahydrofolate ligase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity |
◆ Recombinant Proteins | ||
MTHFD2-5322H | Recombinant Human MTHFD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTHFD2-5779M | Recombinant Mouse MTHFD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTHFD2-571H | Recombinant Human MTHFD2 Protein, His-tagged | +Inquiry |
MTHFD2-10192M | Recombinant Mouse MTHFD2 Protein | +Inquiry |
MTHFD2-395H | Recombinant Human MTHFD2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFD2-4082HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
MTHFD2-4083HCL | Recombinant Human MTHFD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTHFD2 Products
Required fields are marked with *
My Review for All MTHFD2 Products
Required fields are marked with *
0
Inquiry Basket