Recombinant Human MTHFD2, GST-tagged

Cat.No. : MTHFD2-395H
Product Overview : Recombinant Human MTHFD2 (16 a.a. - 344 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in two different transcripts, one protein-coding and the other not protein-coding. This gene has a pseudogene on chromosome 7.
Molecular Mass : 61.93 kDa
AA Sequence : SLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVG INSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYS MLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTIL ADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLM KNTIIAAKKVLRLEEREVLKSKELGVATN
Applications : ELSA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ]
Official Symbol MTHFD2
Synonyms MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; NMDMC; methylenetetrahydrofolate dehydrogenase 2; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase methylene tetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase; EC 1.5.1.15
Gene ID 10797
mRNA Refseq NM_006636
Protein Refseq NP_006627
MIM 604887
UniProt ID P13995
Chromosome Location 2p13.1
Pathway C1-unit interconversion; Nucleotide Metabolism; One carbon pool by folate; tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate
Function NOT formate-tetrahydrofolate ligase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTHFD2 Products

Required fields are marked with *

My Review for All MTHFD2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon