Recombinant Human MTHFD2, GST-tagged

• Cat.No.: MTHFD2-395H
• Product Overview: Recombinant Human MTHFD2 (16 a.a. - 344 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 16-344 aa
• Description: This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in two different transcripts, one protein-coding and the other not protein-coding. This gene has a pseudogene on chromosome 7.
• Molecular Mass: 61.93 kDa
• AA Sequence: SLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVG INSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYS MLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTIL ADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLM KNTIIAAKKVLRLEEREVLKSKELGVATN
• Applications: ELSA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ]
• Official Symbol: MTHFD2
• Synonyms: MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; NMDMC; methylenetetrahydrofolate dehydrogenase 2; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase methylene tetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase; EC 1.5.1.15
• Gene ID: 10797
• mRNA Refseq: NM_006636
• Protein Refseq: NP_006627
• MIM: 604887
• UniProt ID: P13995
• Chromosome Location: 2p13.1
• Pathway: C1-unit interconversion; Nucleotide Metabolism; One carbon pool by folate; tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate
• Function: NOT formate-tetrahydrofolate ligase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity