Recombinant Human MTHFS Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MTHFS-5880H
Product Overview : MTHFS MS Standard C13 and N15-labeled recombinant protein (NP_006432) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene.
Molecular Mass : 23.3 kDa
AA Sequence : MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MTHFS methenyltetrahydrofolate synthetase [ Homo sapiens (human) ]
Official Symbol MTHFS
Synonyms MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268; methenyl-THF synthetase; FLJ30410;
Gene ID 10588
mRNA Refseq NM_006441
Protein Refseq NP_006432
MIM 604197
UniProt ID P49914

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTHFS Products

Required fields are marked with *

My Review for All MTHFS Products

Required fields are marked with *

0
cart-icon