Recombinant Human MTHFS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MTHFS-5880H |
Product Overview : | MTHFS MS Standard C13 and N15-labeled recombinant protein (NP_006432) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an enzyme that catalyzes the conversion of 5-formyltetrahydrofolate to 5,10-methenyltetrahydrofolate, a precursor of reduced folates involved in 1-carbon metabolism. An increased activity of the encoded protein can result in an increased folate turnover rate and folate depletion. Three transcript variants encoding two different isoforms have been found for this gene. |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MTHFS methenyltetrahydrofolate synthetase [ Homo sapiens (human) ] |
Official Symbol | MTHFS |
Synonyms | MTHFS; 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase); 5-formyltetrahydrofolate cyclo-ligase; HsT19268; methenyl-THF synthetase; FLJ30410; |
Gene ID | 10588 |
mRNA Refseq | NM_006441 |
Protein Refseq | NP_006432 |
MIM | 604197 |
UniProt ID | P49914 |
◆ Recombinant Proteins | ||
MTHFS-10195M | Recombinant Mouse MTHFS Protein | +Inquiry |
MTHFS-3464H | Recombinant Human MTHFS protein, His-tagged | +Inquiry |
MTHFS-5781M | Recombinant Mouse MTHFS Protein, His (Fc)-Avi-tagged | +Inquiry |
MTHFS-5880H | Recombinant Human MTHFS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTHFS-5005C | Recombinant Chicken MTHFS | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTHFS-4080HCL | Recombinant Human MTHFS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTHFS Products
Required fields are marked with *
My Review for All MTHFS Products
Required fields are marked with *
0
Inquiry Basket