Recombinant Human MTOR Protein, GST tagged

Cat.No. : MTOR-22H
Product Overview : Recombinant Human MTOR Protein with GST tag was expressed in E. coli.
Availability December 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 2017-2114aa
Description : The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This kinase is a component of two distinct complexes, mTORC1, which controls protein synthesis, cell growth and proliferation, and mTORC2, which is a regulator of the actin cytoskeleton, and promotes cell survival and cell cycle progression. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. Inhibitors of mTOR are used in organ transplants as immunosuppressants, and are being evaluated for their therapeutic potential in SARS-CoV-2 infections. Mutations in this gene are associated with Smith-Kingsmore syndrome and somatic focal cortical dysplasia type II. The ANGPTL7 gene is located in an intron of this gene.
Molecular Mass : 38.4 kDa
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQ
Purity : > 80% by SDS-PAGE
Storage : Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 2.5 mg/mL
Storage Buffer : PBS, pH 7.4
Gene Name MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens (human) ]
Official Symbol MTOR
Synonyms MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1, FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506 binding protein 12 rapamycin associated protein 2; FKBP rapamycin associated protein; FKBP12 rapamycin complex associated protein 1; FLJ44809; mammalian target of rapamycin; RAFT1; rapamycin and FKBP12 target 1; rapamycin associated protein FRAP2; rapamycin target protein; RAPT1; rapamycin target protein 1; FKBP-rapamycin associated protein; FKBP12-rapamycin complex-associated protein 1; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FRAP; FRAP1; FRAP2
Gene ID 2475
mRNA Refseq NM_004958
Protein Refseq NP_004949
MIM 601231
UniProt ID P42345

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTOR Products

Required fields are marked with *

My Review for All MTOR Products

Required fields are marked with *

0
cart-icon
0
compare icon