Recombinant Human MTOR Protein, GST tagged
Cat.No. : | MTOR-22H |
Product Overview : | Recombinant Human MTOR Protein with GST tag was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 2017-2114aa |
Description : | The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This kinase is a component of two distinct complexes, mTORC1, which controls protein synthesis, cell growth and proliferation, and mTORC2, which is a regulator of the actin cytoskeleton, and promotes cell survival and cell cycle progression. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. Inhibitors of mTOR are used in organ transplants as immunosuppressants, and are being evaluated for their therapeutic potential in SARS-CoV-2 infections. Mutations in this gene are associated with Smith-Kingsmore syndrome and somatic focal cortical dysplasia type II. The ANGPTL7 gene is located in an intron of this gene. |
Molecular Mass : | 38.4 kDa |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQ |
Purity : | > 80% by SDS-PAGE |
Storage : | Store it at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 2.5 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | MTOR mechanistic target of rapamycin (serine/threonine kinase) [ Homo sapiens (human) ] |
Official Symbol | MTOR |
Synonyms | MTOR; mechanistic target of rapamycin (serine/threonine kinase); FK506 binding protein 12 rapamycin associated protein 1, FRAP, FRAP1, FRAP2; serine/threonine-protein kinase mTOR; dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1); FK506 binding protein 12 rapamycin associated protein 2; FKBP rapamycin associated protein; FKBP12 rapamycin complex associated protein 1; FLJ44809; mammalian target of rapamycin; RAFT1; rapamycin and FKBP12 target 1; rapamycin associated protein FRAP2; rapamycin target protein; RAPT1; rapamycin target protein 1; FKBP-rapamycin associated protein; FKBP12-rapamycin complex-associated protein 1; FK506 binding protein 12-rapamycin associated protein 1; FK506 binding protein 12-rapamycin associated protein 2; FK506-binding protein 12-rapamycin complex-associated protein 1; FRAP; FRAP1; FRAP2 |
Gene ID | 2475 |
mRNA Refseq | NM_004958 |
Protein Refseq | NP_004949 |
MIM | 601231 |
UniProt ID | P42345 |
◆ Recombinant Proteins | ||
MTOR-30254TH | Recombinant Human MTOR | +Inquiry |
MTOR-156H | Recombinant Human MTOR, MYC/DDK-tagged | +Inquiry |
MTOR-4973H | Recombinant Human MTOR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MTOR-4805HFL | Recombinant Full Length Human MTOR, Flag-tagged | +Inquiry |
MTOR-3815R | Recombinant Rat MTOR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTOR-4068HCL | Recombinant Human MTOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTOR Products
Required fields are marked with *
My Review for All MTOR Products
Required fields are marked with *