Recombinant Human MTPN Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MTPN-2319H |
Product Overview : | MTPN MS Standard C13 and N15-labeled recombinant protein (NP_665807) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease. |
Molecular Mass : | 12.9 kDa |
AA Sequence : | MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MTPN myotrophin [ Homo sapiens (human) ] |
Official Symbol | MTPN |
Synonyms | MTPN; myotrophin; GCDP; granule cell differentiation protein; MYOTROPHIN; V 1; |
Gene ID | 136319 |
mRNA Refseq | NM_145808 |
Protein Refseq | NP_665807 |
MIM | 606484 |
UniProt ID | P58546 |
◆ Recombinant Proteins | ||
Mtpn-4223M | Recombinant Mouse Mtpn Protein, Myc/DDK-tagged | +Inquiry |
MTPN-2724R | Recombinant Rhesus Macaque MTPN Protein, His (Fc)-Avi-tagged | +Inquiry |
MTPN-2180H | Recombinant Human MTPN Protein, MYC/DDK-tagged | +Inquiry |
MTPN-3475R | Recombinant Rat MTPN Protein, His (Fc)-Avi-tagged | +Inquiry |
MTPN-6558HF | Recombinant Full Length Human MTPN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTPN-1153HCL | Recombinant Human MTPN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTPN Products
Required fields are marked with *
My Review for All MTPN Products
Required fields are marked with *
0
Inquiry Basket