Recombinant Human MTPN Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MTPN-2319H
Product Overview : MTPN MS Standard C13 and N15-labeled recombinant protein (NP_665807) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease.
Molecular Mass : 12.9 kDa
AA Sequence : MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MTPN myotrophin [ Homo sapiens (human) ]
Official Symbol MTPN
Synonyms MTPN; myotrophin; GCDP; granule cell differentiation protein; MYOTROPHIN; V 1;
Gene ID 136319
mRNA Refseq NM_145808
Protein Refseq NP_665807
MIM 606484
UniProt ID P58546

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTPN Products

Required fields are marked with *

My Review for All MTPN Products

Required fields are marked with *

0
cart-icon
0
compare icon