Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at Attend ADLM 2024 | July 28 - August 1, 2024

Recombinant Human MUC1, His-tagged

Cat.No. : MUC1-27747TH
Product Overview : Recombinant Human MUC1(1095 to 1140) fussed with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Mucin 1, cell surface associated (MUC1) or polymorphic epithelial mucin (PEM) is a mucin encoded by the MUC1 gene in humans. MUC1 is a glycoprotein with extensive O-linked glycosylation of its extracellular domain. Mucins line the apical surface of epithelial cells in the lungs, stomach, intestines, eyes and several other organs. Mucins protect the body from infection by pathogen binding to oligosaccharides in the extracellular domain, preventing the pathogen from reaching the cell surface. Overexpression of MUC1 is often associated with colon, breast, ovarian, lung and pancreatic cancers. Joyce Taylor-Papadimitriou identified and characterised the antigen during her work with breast and ovarian tumors.
Source : E. coli
Species : Human
Tag : His
Form : Lyophilised
Molecular Mass : 14 kDa including tags(His tag is 4kDa, Fusion protein size is 10 kDa)
AA Sequence : RPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVS
Applications : Western blot; ELISA; SDS-PAGE
Stability : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.Preservative: NoneConstituents: PBS
Storage : Store at -20°C
Reconstitution : Redissolve the powder with 1ml sterile water.
Gene Name : MUC1 mucin 1, cell surface associated [ Homo sapiens ]
Official Symbol : MUC1
Synonyms : EMA; MCD; PEM; PUM; KL-6; MAM6; MCKD; PEMT; CD227; H23AG; MCKD1; MUC-1; ADMCKD; ADMCKD1; CA 15-3; MUC-1/X; MUC1/ZD; MUC-1/SEC; mucin-1; DF3 antigen; H23 antigen; Medullary cystic kidney disease, autosomal dominant; breast carcinoma-associated antigen DF3; cancer antigen 15-3; carcinoma-associated mucin; episialin; krebs von den Lungen-6; mucin 1, transmembrane; peanut-reactive urinary mucin; polymorphic epithelial mucin; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen
Gene ID : 4582
mRNA Refseq : NM_001018016
Protein Refseq : NP_001018016
MIM : 158340
UniProt ID : P15941
Chromosome Location : 1q21
Pathway : IL-7 Signaling Pathway, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; O-linked glycosylation, organism-specific biosystem
Function : p53 binding; protein binding; transcription cofactor activity

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (3)

Write a review
Reviews
03/11/2022

    It is suitable for crystallography research and has good crystallinity.

    02/04/2022

      Target immune responses can be successfully induced.

      06/04/2019

        Enzymatic experiments showed that the catalytic efficiency was high

        Q&As (6)

        Ask a question
        What are the structural characteristics of the MUC1 protein? 11/12/2019

        The MUC1 protein consists of a short extracellular region, a transmembrane region, and a long intracellular region. The extracellular region is rich in sugar chains, which make the MUC1 protein adherent.

        What is the role of the MUC1 protein in cancer? 10/16/2019

        In cancer, the expression of the MUC1 protein usually increases abnormally and changes in glycosylation occur. This can affect cell adhesion, proliferation, and invasion, promoting the spread and metastasis of cancer cells.

        Is the MUC1 protein involved in the immune system? 09/02/2019

        Yes, the MUC1 protein is closely related to the immune system. In some cases, abnormal expression of the MUC1 protein may interfere with the function of immune cells, thereby reducing the immune response.

        In which diseases is MUC1 involved in the diagnosis and treatment? 08/17/2019

        MUC1 protein is overexpressed in many types of cancer, including breast, stomach, ovarian, and others. Therefore, the MUC1 protein can be a potential target for cancer diagnosis and treatment.

        What are the main physiological functions of MUC1 protein? 06/22/2019

        The MUC1 protein mainly plays the role of protecting and lubricating the mucosal surface. It prevents bacteria and other pathogens from entering our body, while also helping to maintain cell-to-cell adhesion.

        Is the MUC1 protein associated with other diseases? 06/01/2019

        MUC1 protein may be associated with a number of other diseases, such as lung infections and inflammatory bowel disease. However, the research related to cancer is more extensive and in-depth.

        Ask a Question for All MUC1 Products

        Required fields are marked with *

        My Review for All MUC1 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /
        • Service lnquiry:

        Stay Updated on the Latest Bioscience Trends