Recombinant Human MUC1 protein, GST-tagged

Cat.No. : MUC1-6733H
Product Overview : Recombinant Human MUC1 protein(24-130 aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-130 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : SGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name MUC1 mucin 1, cell surface associated [ Homo sapiens ]
Official Symbol MUC1
Synonyms MUC1; mucin 1, cell surface associated; mucin 1, transmembrane , PUM; mucin-1; CD227; PEM; episialin; DF3 antigen; H23 antigen; krebs von den Lungen-6; mucin 1, transmembrane; tumor-associated mucin; carcinoma-associated mucin; polymorphic epithelial mucin; peanut-reactive urinary mucin; tumor associated epithelial mucin; breast carcinoma-associated antigen DF3; tumor-associated epithelial membrane antigen; EMA; PUM; KL-6; MAM6; PEMT; H23AG; MUC-1; MUC-1/X; MUC1/ZD; MUC-1/SEC;
Gene ID 4582
mRNA Refseq NM_001018016
Protein Refseq NP_001018016
MIM 158340
UniProt ID P15941

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC1 Products

Required fields are marked with *

My Review for All MUC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon