Recombinant Human MUC1 protein, GST-tagged
Cat.No. : | MUC1-6733H |
Product Overview : | Recombinant Human MUC1 protein(24-130 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-130 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | SGHASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | MUC1 mucin 1, cell surface associated [ Homo sapiens ] |
Official Symbol | MUC1 |
Synonyms | MUC1; mucin 1, cell surface associated; mucin 1, transmembrane , PUM; mucin-1; CD227; PEM; episialin; DF3 antigen; H23 antigen; krebs von den Lungen-6; mucin 1, transmembrane; tumor-associated mucin; carcinoma-associated mucin; polymorphic epithelial mucin; peanut-reactive urinary mucin; tumor associated epithelial mucin; breast carcinoma-associated antigen DF3; tumor-associated epithelial membrane antigen; EMA; PUM; KL-6; MAM6; PEMT; H23AG; MUC-1; MUC-1/X; MUC1/ZD; MUC-1/SEC; |
Gene ID | 4582 |
mRNA Refseq | NM_001018016 |
Protein Refseq | NP_001018016 |
MIM | 158340 |
UniProt ID | P15941 |
◆ Recombinant Proteins | ||
MUC1-726H | Recombinant Human MUC1 protein, Fc-tagged | +Inquiry |
MUC1-211H | Recombinant Human MUC1 Protein, DYKDDDDK-tagged | +Inquiry |
Muc1-621M | Recombinant Mouse Muc1 Protein, His/GST-tagged | +Inquiry |
MUC1-261H | Recombinant Human MUC1 Protein, mFc-tagged | +Inquiry |
MUC1-5801M | Recombinant Mouse MUC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MUC1-376H | Active Native Human MUC1 | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
MUC1-135B | Native Bovine MUC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MUC1-1980HCL | Recombinant Human MUC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC1 Products
Required fields are marked with *
My Review for All MUC1 Products
Required fields are marked with *