Recombinant Human MUC2 Protein, GST tagged
Cat.No. : | MUC2-1515H |
Product Overview : | Recombinant Human MUC2 Protein with GST tag was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Downregulation of this gene has been observed in patients with Crohn disease and ulcerative colitis. |
Molecular Mass : | The protein has a calculated MW of 50 kDa. |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLNVIACTHVPCNTSCSPGFELMEAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRAR |
Purity : | > 85% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.27 mg/mL by Bradford |
Storage Buffer : | Sterile 50 mM Tris-Acetate, pH7.5, 1 mM EDTA, 20% Glycerol |
Publications : |
Effect of a Semi-Purified Oligosaccharide-Enriched Fraction from Caprine Milk on Barrier Integrity and Mucin Production of Co-Culture Models of the Small and Large Intestinal Epithelium. (2016)
The Vat-AIEC protease promotes crossing of the intestinal mucus layer by Crohn's disease-associated Escherichia coli. (2015)
Metabolism of caprine milk carbohydrates by probiotic bacteria and Caco-2: HT29–MTX epithelial co-cultures and their impact on intestinal barrier integrity (2018)
|
Gene Name | MUC2 mucin 2, oligomeric mucus/gel-forming [ Homo sapiens (human) ] |
Official Symbol | MUC2 |
Synonyms | MUC2; mucin 2, oligomeric mucus/gel-forming; MLP; SMUC; MUC-2; mucin-2; mucin 2, intestinal/tracheal |
Gene ID | 4583 |
mRNA Refseq | NM_002457 |
Protein Refseq | NP_002448 |
MIM | 158370 |
UniProt ID | Q02817 |
◆ Recombinant Proteins | ||
Muc2-1803R | Recombinant Rat Muc2 Protein, His-tagged | +Inquiry |
MUC2-3254H | Recombinant Human MUC2 protein, His-tagged | +Inquiry |
Muc2-690M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
MUC2-155H | Recombinant Human MUC2 Protein, GST-tagged | +Inquiry |
Muc2-691M | Recombinant Mouse Muc2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MUC2-28P | Native Pig Mucin 2 (MUC2) Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC2 Products
Required fields are marked with *
My Review for All MUC2 Products
Required fields are marked with *