Recombinant Human MUC5B protein, His&Myc-tagged
Cat.No. : | MUC5B-4400H |
Product Overview : | Recombinant Human MUC5B protein(Q9HC84)(4186-4295aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 4186-4295aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.9 kDa |
AA Sequence : | ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | MUC5B mucin 5B, oligomeric mucus/gel-forming [ Homo sapiens ] |
Official Symbol | MUC5B |
Synonyms | MUC5B; mucin 5B, oligomeric mucus/gel-forming; MUC5, mucin 5, subtype B, tracheobronchial; mucin-5B; MG1; cervical mucin MUC5B; sublingual gland mucin; mucin 5, subtype B, tracheobronchial; high molecular weight salivary mucin MG1; MUC5; MUC9; MUC-5B; |
Gene ID | 727897 |
mRNA Refseq | NM_002458 |
Protein Refseq | NP_002449 |
MIM | 600770 |
UniProt ID | Q9HC84 |
◆ Recombinant Proteins | ||
MUC5B-783C | Recombinant Cattle MUC5B protein, His-tagged | +Inquiry |
Muc5b-788R | Recombinant Rat Muc5b protein, His & GST-tagged | +Inquiry |
Muc5b-787R | Recombinant Rat Muc5b protein, His & GST-tagged | +Inquiry |
Muc5b-785M | Recombinant Mouse Muc5b protein, His-tagged | +Inquiry |
MUC5B-4400H | Recombinant Human MUC5B protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC5B Products
Required fields are marked with *
My Review for All MUC5B Products
Required fields are marked with *