Recombinant Human MUC5B protein, His&Myc-tagged

Cat.No. : MUC5B-4400H
Product Overview : Recombinant Human MUC5B protein(Q9HC84)(4186-4295aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 4186-4295aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.9 kDa
AA Sequence : ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name MUC5B mucin 5B, oligomeric mucus/gel-forming [ Homo sapiens ]
Official Symbol MUC5B
Synonyms MUC5B; mucin 5B, oligomeric mucus/gel-forming; MUC5, mucin 5, subtype B, tracheobronchial; mucin-5B; MG1; cervical mucin MUC5B; sublingual gland mucin; mucin 5, subtype B, tracheobronchial; high molecular weight salivary mucin MG1; MUC5; MUC9; MUC-5B;
Gene ID 727897
mRNA Refseq NM_002458
Protein Refseq NP_002449
MIM 600770
UniProt ID Q9HC84

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC5B Products

Required fields are marked with *

My Review for All MUC5B Products

Required fields are marked with *

0
cart-icon