Recombinant Human MUC5B protein, His&Myc-tagged

• Cat.No.: MUC5B-4400H
• Product Overview: Recombinant Human MUC5B protein(Q9HC84)(4186-4295aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 4186-4295aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.9 kDa
• AA Sequence: ELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MUC5B mucin 5B, oligomeric mucus/gel-forming [ Homo sapiens ]
• Official Symbol: MUC5B
• Synonyms: MUC5B; mucin 5B, oligomeric mucus/gel-forming; MUC5, mucin 5, subtype B, tracheobronchial; mucin-5B; MG1; cervical mucin MUC5B; sublingual gland mucin; mucin 5, subtype B, tracheobronchial; high molecular weight salivary mucin MG1; MUC5; MUC9; MUC-5B
• Gene ID: 727897
• mRNA Refseq: NM_002458
• Protein Refseq: NP_002449
• MIM: 600770
• UniProt ID: Q9HC84