Recombinant Human MUC7 Protein, GST-tagged

Cat.No. : MUC7-5751H
Product Overview : Human MUC7 partial ORF ( NP_689504, 36 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5 UTR, but encoding the same protein, have been found for this gene
Molecular Mass : 36.74 kDa
AA Sequence : HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MUC7 mucin 7, secreted [ Homo sapiens ]
Official Symbol MUC7
Synonyms MUC7; mucin 7, secreted; mucin 7, salivary; mucin-7; FLJ27047; MG2; MUC-7; apo-MG2; salivary mucin-7; MGC34772; DKFZp686J03256;
Gene ID 4589
mRNA Refseq NM_001145006
Protein Refseq NP_001138478
MIM 158375
UniProt ID Q8TAX7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC7 Products

Required fields are marked with *

My Review for All MUC7 Products

Required fields are marked with *

0
cart-icon
0
compare icon