Recombinant Human MUC7 Protein, GST-tagged
Cat.No. : | MUC7-5751H |
Product Overview : | Human MUC7 partial ORF ( NP_689504, 36 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a small salivary mucin, which is thought to play a role in facilitating the clearance of bacteria in the oral cavity and to aid in mastication, speech, and swallowing. The central domain of this glycoprotein contains tandem repeats, each composed of 23 amino acids. The most common allele contains 6 repeats, and some alleles may be associated with susceptibility to asthma. Alternatively spliced transcript variants with different 5 UTR, but encoding the same protein, have been found for this gene |
Molecular Mass : | 36.74 kDa |
AA Sequence : | HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MUC7 mucin 7, secreted [ Homo sapiens ] |
Official Symbol | MUC7 |
Synonyms | MUC7; mucin 7, secreted; mucin 7, salivary; mucin-7; FLJ27047; MG2; MUC-7; apo-MG2; salivary mucin-7; MGC34772; DKFZp686J03256; |
Gene ID | 4589 |
mRNA Refseq | NM_001145006 |
Protein Refseq | NP_001138478 |
MIM | 158375 |
UniProt ID | Q8TAX7 |
◆ Recombinant Proteins | ||
MUC7-3644H | Recombinant Human MUC7 protein, GST-tagged | +Inquiry |
MUC7-4644H | Recombinant Human MUC7 protein, His-PDI-tagged | +Inquiry |
MUC7-1806H | Recombinant Human MUC7 Protein, His&GST-tagged | +Inquiry |
MUC7-28540TH | Recombinant Human MUC7 | +Inquiry |
MUC7-5751H | Recombinant Human MUC7 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC7 Products
Required fields are marked with *
My Review for All MUC7 Products
Required fields are marked with *
0
Inquiry Basket