Recombinant Human MUC7 protein, GST-tagged
Cat.No. : | MUC7-3644H |
Product Overview : | Recombinant Human MUC7 protein(22-95 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 22-95 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | GRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPD |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MUC7 mucin 7, secreted [ Homo sapiens ] |
Official Symbol | MUC7 |
Synonyms | MUC7; mucin 7, secreted; mucin 7, salivary; mucin-7; FLJ27047; MG2; MUC-7; apo-MG2; salivary mucin-7; MGC34772; DKFZp686J03256; |
Gene ID | 4589 |
mRNA Refseq | NM_001145006 |
Protein Refseq | NP_001138478 |
MIM | 158375 |
UniProt ID | Q8TAX7 |
◆ Recombinant Proteins | ||
MUC7-1806H | Recombinant Human MUC7 Protein, His&GST-tagged | +Inquiry |
MUC7-28540TH | Recombinant Human MUC7 | +Inquiry |
MUC7-3644H | Recombinant Human MUC7 protein, GST-tagged | +Inquiry |
MUC7-5751H | Recombinant Human MUC7 Protein, GST-tagged | +Inquiry |
MUC7-4644H | Recombinant Human MUC7 protein, His-PDI-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUC7 Products
Required fields are marked with *
My Review for All MUC7 Products
Required fields are marked with *