Recombinant Human MUC7 protein, His-PDI-tagged

Cat.No. : MUC7-4644H
Product Overview : Recombinant Human MUC7 protein(Q8TAX7)(23-377aa), fused with N-terminal His and PDI tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His&PDI
Protein Length : 23-377aa
Tag : N-His-PDI
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 95.7 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : RERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFLLYMKNLLNRIIDDMVEQ
Gene Name MUC7 mucin 7, secreted [ Homo sapiens ]
Official Symbol MUC7
Synonyms MUC7; mucin 7, secreted; mucin 7, salivary; mucin-7; FLJ27047; MG2; MUC-7; apo-MG2; salivary mucin-7; MGC34772; DKFZp686J03256;
Gene ID 4589
mRNA Refseq NM_001145006
Protein Refseq NP_001138478
MIM 158375
UniProt ID Q8TAX7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUC7 Products

Required fields are marked with *

My Review for All MUC7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon