Recombinant Human MVB12B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: MVB12B-3689H
• Product Overview: FAM125B MS Standard C13 and N15-labeled recombinant protein (NP_001011703) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 24.5 kDa
• AA Sequence: MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: MVB12B multivesicular body subunit 12B [ Homo sapiens (human) ]
• Official Symbol: MVB12B
• Synonyms: MVB12B; multivesicular body subunit 12B; C9orf28; FAM125B; multivesicular body subunit 12B; ESCRT-I complex subunit MVB12B; family with sequence similarity 125, member B
• Gene ID: 89853
• mRNA Refseq: NM_001011703
• Protein Refseq: NP_001011703
• UniProt ID: Q9H7P6