Recombinant Human MVB12B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MVB12B-3689H
Product Overview : FAM125B MS Standard C13 and N15-labeled recombinant protein (NP_001011703) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a component of the ESCRT-I complex, a heterotetramer, which mediates the sorting of ubiquitinated cargo protein from the plasma membrane to the endosomal vesicle. ESCRT-I complex plays an essential role in HIV budding and endosomal protein sorting. Depletion and overexpression of this and related protein (MVB12A) inhibit HIV-1 infectivity and induce unusual viral assembly defects, indicating a role for MVB12 subunits in regulating ESCRT-mediated virus budding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 24.5 kDa
AA Sequence : MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIKDTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MVB12B multivesicular body subunit 12B [ Homo sapiens (human) ]
Official Symbol MVB12B
Synonyms MVB12B; multivesicular body subunit 12B; C9orf28; FAM125B; multivesicular body subunit 12B; ESCRT-I complex subunit MVB12B; family with sequence similarity 125, member B
Gene ID 89853
mRNA Refseq NM_001011703
Protein Refseq NP_001011703
UniProt ID Q9H7P6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MVB12B Products

Required fields are marked with *

My Review for All MVB12B Products

Required fields are marked with *

0
cart-icon
0
compare icon