Recombinant Human MYBPC3 Protein, His-SUMO-tagged
| Cat.No. : | MYBPC3-1289H |
| Product Overview : | Recombinant Human MYBPC3 Protein (1-328aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-328 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 50.8 kDa |
| AA Sequence : | MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | MYBPC3 myosin binding protein C, cardiac [ Homo sapiens ] |
| Official Symbol | MYBPC3 |
| Synonyms | MYBPC3; myosin binding protein C, cardiac; CMH4, myosin binding protein C, cardiac; myosin-binding protein C, cardiac-type; FHC; MYBP C; C-protein, cardiac muscle isoform; myosin-binding protein C, cardiac; CMH4; MYBP-C; DKFZp779E1762 |
| Gene ID | 4607 |
| mRNA Refseq | NM_000256 |
| Protein Refseq | NP_000247 |
| MIM | 600958 |
| UniProt ID | Q14896 |
| ◆ Recombinant Proteins | ||
| MYBPC3-3495R | Recombinant Rat MYBPC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYBPC3-4636H | Recombinant Human MYBPC3 Protein (Met1-Ala328), N-His tagged | +Inquiry |
| MYBPC3-01H | Recombinant Human MYBPC3 Protein, His-Tagged | +Inquiry |
| MYBPC3-943H | Recombinant Human MYBPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MYBPC3-19H | Recombinant Human MYBPC3 protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYBPC3 Products
Required fields are marked with *
My Review for All MYBPC3 Products
Required fields are marked with *
