Recombinant Human MYBPC3 Protein, His-SUMO-tagged
Cat.No. : | MYBPC3-1289H |
Product Overview : | Recombinant Human MYBPC3 Protein (1-328aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-328 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | MYBPC3 myosin binding protein C, cardiac [ Homo sapiens ] |
Official Symbol | MYBPC3 |
Synonyms | MYBPC3; myosin binding protein C, cardiac; CMH4, myosin binding protein C, cardiac; myosin-binding protein C, cardiac-type; FHC; MYBP C; C-protein, cardiac muscle isoform; myosin-binding protein C, cardiac; CMH4; MYBP-C; DKFZp779E1762 |
Gene ID | 4607 |
mRNA Refseq | NM_000256 |
Protein Refseq | NP_000247 |
MIM | 600958 |
UniProt ID | Q14896 |
◆ Recombinant Proteins | ||
MYBPC3-1125H | Recombinant Human MYBPC3 protein, His-tagged | +Inquiry |
MYBPC3-4636H | Recombinant Human MYBPC3 Protein (Met1-Ala328), N-His tagged | +Inquiry |
MYBPC3-3886Z | Recombinant Zebrafish MYBPC3 | +Inquiry |
MYBPC3-1467R | Recombinant Rat MYBPC3 Protein (645-864 aa), His-tagged | +Inquiry |
MYBPC3-9131HFL | Recombinant Full Length Human MYBPC3 protein, Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYBPC3 Products
Required fields are marked with *
My Review for All MYBPC3 Products
Required fields are marked with *
0
Inquiry Basket