Recombinant Human MYD88 protein, GST-tagged
Cat.No. : | MYD88-301137H |
Product Overview : | Recombinant Human MYD88 (1-150 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu150 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ] |
Official Symbol | MYD88 |
Synonyms | MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; MYD88D; |
Gene ID | 4615 |
mRNA Refseq | NM_001172566 |
Protein Refseq | NP_001166037 |
MIM | 602170 |
UniProt ID | Q99836 |
◆ Recombinant Proteins | ||
Myd88-4241M | Recombinant Mouse Myd88 Protein, Myc/DDK-tagged | +Inquiry |
MYD88-7112H | Recombinant Human MYD88, His-tagged | +Inquiry |
MYD88-1550H | Recombinant Human Myeloid Differentiation Primary Response Gene (88) | +Inquiry |
MYD88-301138H | Recombinant Human MYD88 protein, His-tagged | +Inquiry |
MYD88-0071H | Recombinant Human MYD88 Protein (M157-P296), Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *