Recombinant Human MYD88 protein, GST-tagged
| Cat.No. : | MYD88-301137H |
| Product Overview : | Recombinant Human MYD88 (1-150 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Leu150 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ] |
| Official Symbol | MYD88 |
| Synonyms | MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; MYD88D; |
| Gene ID | 4615 |
| mRNA Refseq | NM_001172566 |
| Protein Refseq | NP_001166037 |
| MIM | 602170 |
| UniProt ID | Q99836 |
| ◆ Recombinant Proteins | ||
| MYD88-4640H | Recombinant Human MYD88 Protein (Met157-Pro296), N-His tagged | +Inquiry |
| MYD88-0071H | Recombinant Human MYD88 Protein (M157-P296), Tag Free | +Inquiry |
| MYD88-3502R | Recombinant Rat MYD88 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYD88-687HFL | Recombinant Full Length Human MYD88 Protein, C-Flag-tagged | +Inquiry |
| MYD88-272H | Recombinant Human MYD88 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *



