Recombinant Human MYF6 Protein, GST-tagged
Cat.No. : | MYF6-5801H |
Product Overview : | Human MYF6 full-length ORF ( NP_002460.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM). [provided by RefSeq, May 2010] |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYF6 myogenic factor 6 (herculin) [ Homo sapiens ] |
Official Symbol | MYF6 |
Synonyms | MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4; muscle-specific regulatory factor 4; class C basic helix-loop-helix protein 4; CNM3; myf-6; |
Gene ID | 4618 |
mRNA Refseq | NM_002469 |
Protein Refseq | NP_002460 |
MIM | 159991 |
UniProt ID | P23409 |
◆ Recombinant Proteins | ||
MYF6-5801H | Recombinant Human MYF6 Protein, GST-tagged | +Inquiry |
MYF6-1181Z | Recombinant Zebrafish MYF6 | +Inquiry |
MYF6-10297M | Recombinant Mouse MYF6 Protein | +Inquiry |
MYF6-3503R | Recombinant Rat MYF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYF6-29361TH | Recombinant Human MYF6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYF6-4033HCL | Recombinant Human MYF6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYF6 Products
Required fields are marked with *
My Review for All MYF6 Products
Required fields are marked with *