Recombinant Human MYF6 Protein, GST-tagged

• Cat.No.: MYF6-5801H
• Product Overview: Human MYF6 full-length ORF ( NP_002460.1, 1 a.a. - 242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM). [provided by RefSeq, May 2010]
• Molecular Mass: 53.4 kDa
• AA Sequence: MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYF6 myogenic factor 6 (herculin) [ Homo sapiens ]
• Official Symbol: MYF6
• Synonyms: MYF6; myogenic factor 6 (herculin); myogenic factor 6; bHLHc4; MRF4; muscle-specific regulatory factor 4; class C basic helix-loop-helix protein 4; CNM3; myf-6
• Gene ID: 4618
• mRNA Refseq: NM_002469
• Protein Refseq: NP_002460
• MIM: 159991
• UniProt ID: P23409