Recombinant Human MYO1A Protein, GST-tagged

Cat.No. : MYO1A-5830H
Product Overview : Human MYO1A partial ORF ( NP_005370, 944 a.a. - 1043 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the myosin superfamily. Myosins are molecular motors that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force. Each myosin has a conserved N-terminal motor domain that contains both ATP-binding and actin-binding sequences. Following the motor domain is a light-chain-binding neck region containing 1-6 copies of a repeat element, the IQ motif, that serves as a binding site for calmodulin or other members of the EF-hand superfamily of calcium-binding proteins. At the C-terminus, each myosin class has a distinct tail domain that serves in dimerization, membrane binding, protein binding, and/or enzymatic activities and targets each myosin to its particular subcellular location. The kidney epithelial cell line, LLC-PK1-CL4 (CL4), forms a well ordered brush border (BB) on its apical surface. Experiments indicate that the brush border population of the encoded protein turns over rapidly, while its head and tail domains interact transiently with the core actin and plasma membrane, respectively. A rapidly exchanging pool of the protein encoded by this gene envelops an actin core bundle that, by comparison, is static in structure. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : SVTSLKDGLFSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRYKKKGSHCLEVTVQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO1A myosin IA [ Homo sapiens ]
Official Symbol MYO1A
Synonyms MYO1A; myosin IA; DFNA48, MYHL; unconventional myosin-Ia; myosin I heavy chain; brush border myosin I; myosin, heavy polypeptide-like (100kD); BBMI; MIHC; MYHL; DFNA48;
Gene ID 4640
mRNA Refseq NM_001256041
Protein Refseq NP_001242970
MIM 601478
UniProt ID Q9UBC5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYO1A Products

Required fields are marked with *

My Review for All MYO1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon