Recombinant Human MYO1A Protein, GST-tagged
Cat.No. : | MYO1A-5830H |
Product Overview : | Human MYO1A partial ORF ( NP_005370, 944 a.a. - 1043 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the myosin superfamily. Myosins are molecular motors that, upon interaction with actin filaments, utilize energy from ATP hydrolysis to generate mechanical force. Each myosin has a conserved N-terminal motor domain that contains both ATP-binding and actin-binding sequences. Following the motor domain is a light-chain-binding neck region containing 1-6 copies of a repeat element, the IQ motif, that serves as a binding site for calmodulin or other members of the EF-hand superfamily of calcium-binding proteins. At the C-terminus, each myosin class has a distinct tail domain that serves in dimerization, membrane binding, protein binding, and/or enzymatic activities and targets each myosin to its particular subcellular location. The kidney epithelial cell line, LLC-PK1-CL4 (CL4), forms a well ordered brush border (BB) on its apical surface. Experiments indicate that the brush border population of the encoded protein turns over rapidly, while its head and tail domains interact transiently with the core actin and plasma membrane, respectively. A rapidly exchanging pool of the protein encoded by this gene envelops an actin core bundle that, by comparison, is static in structure. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SVTSLKDGLFSLHLSEMSSVGSKGDFLLVSEHVIELLTKMYRAVLDATQRQLTVTVTEKFSVRFKENSVAVKVVQGPAGGDNSKLRYKKKGSHCLEVTVQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYO1A myosin IA [ Homo sapiens ] |
Official Symbol | MYO1A |
Synonyms | MYO1A; myosin IA; DFNA48, MYHL; unconventional myosin-Ia; myosin I heavy chain; brush border myosin I; myosin, heavy polypeptide-like (100kD); BBMI; MIHC; MYHL; DFNA48; |
Gene ID | 4640 |
mRNA Refseq | NM_001256041 |
Protein Refseq | NP_001242970 |
MIM | 601478 |
UniProt ID | Q9UBC5 |
◆ Recombinant Proteins | ||
MYO1A-10333M | Recombinant Mouse MYO1A Protein | +Inquiry |
Myo1a-538M | Recombinant Mouse Myo1a Protein, His-tagged | +Inquiry |
MYO1A-30273TH | Recombinant Human MYO1A | +Inquiry |
MYO1A-5830H | Recombinant Human MYO1A Protein, GST-tagged | +Inquiry |
MYO1A-537H | Recombinant Human MYO1A Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYO1A-4010HCL | Recombinant Human MYO1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYO1A Products
Required fields are marked with *
My Review for All MYO1A Products
Required fields are marked with *