Recombinant Human MYT1 Protein, GST-tagged
| Cat.No. : | MYT1-5868H |
| Product Overview : | Human MYT1 partial ORF ( NP_004526, 586 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYT1 myelin transcription factor 1 [ Homo sapiens ] |
| Official Symbol | MYT1 |
| Synonyms | MYT1; myelin transcription factor 1; PLPB1; MTF1; MYTI; myelin transcription factor I; proteolipid protein binding protein; proteolipid protein-binding protein; C20orf36; |
| Gene ID | 4661 |
| mRNA Refseq | NM_004535 |
| Protein Refseq | NP_004526 |
| MIM | 600379 |
| UniProt ID | Q01538 |
| ◆ Recombinant Proteins | ||
| MYT1-3003H | Recombinant Human MYT1 Protein, His-tagged | +Inquiry |
| Myt1-7971M | Recombinant Mouse Myt1 protein, His & T7-tagged | +Inquiry |
| MYT1-3005H | Recombinant Human MYT1 Protein, His-tagged | +Inquiry |
| MYT1-1288H | Recombinant Human MYT1 Protein (900-1101 aa), His-tagged | +Inquiry |
| MYT1-3002H | Recombinant Human MYT1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYT1-1163HCL | Recombinant Human MYT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYT1 Products
Required fields are marked with *
My Review for All MYT1 Products
Required fields are marked with *
