Recombinant Human MYT1 Protein, GST-tagged
Cat.No. : | MYT1-5868H |
Product Overview : | Human MYT1 partial ORF ( NP_004526, 586 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq |
Molecular Mass : | 36.63 kDa |
AA Sequence : | DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYT1 myelin transcription factor 1 [ Homo sapiens ] |
Official Symbol | MYT1 |
Synonyms | MYT1; myelin transcription factor 1; PLPB1; MTF1; MYTI; myelin transcription factor I; proteolipid protein binding protein; proteolipid protein-binding protein; C20orf36; |
Gene ID | 4661 |
mRNA Refseq | NM_004535 |
Protein Refseq | NP_004526 |
MIM | 600379 |
UniProt ID | Q01538 |
◆ Recombinant Proteins | ||
MYT1-3006H | Recombinant Human MYT1 Protein, His-tagged | +Inquiry |
MYT1-17H | Recombinant Active Human MYT1 Protein (Full length), N-His-tagged | +Inquiry |
MYT1-4657H | Recombinant Human MYT1 Protein (His903-Val1121), N-His tagged | +Inquiry |
MYT1-3004H | Recombinant Human MYT1 Protein, GST-tagged | +Inquiry |
MYT1-1156H | Recombinant Human MYT1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYT1-1163HCL | Recombinant Human MYT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYT1 Products
Required fields are marked with *
My Review for All MYT1 Products
Required fields are marked with *