Recombinant Human MYT1 Protein, GST-tagged

Cat.No. : MYT1-5868H
Product Overview : Human MYT1 partial ORF ( NP_004526, 586 a.a. - 685 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : DYASFDAQVFGKRMLAPKIQTSETSPKAFQCFDYSQDAEAAHMAATAILNLSTRCWEMPENLSTKPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYT1 myelin transcription factor 1 [ Homo sapiens ]
Official Symbol MYT1
Synonyms MYT1; myelin transcription factor 1; PLPB1; MTF1; MYTI; myelin transcription factor I; proteolipid protein binding protein; proteolipid protein-binding protein; C20orf36;
Gene ID 4661
mRNA Refseq NM_004535
Protein Refseq NP_004526
MIM 600379
UniProt ID Q01538

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYT1 Products

Required fields are marked with *

My Review for All MYT1 Products

Required fields are marked with *

0
cart-icon
0
compare icon