Recombinant Human MYT1 protein, His-tagged
Cat.No. : | MYT1-3002H |
Product Overview : | Recombinant Human MYT1 protein(1-132 aa), fused to His tag, was expressed in E. coli. |
Availability | August 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-132 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSLENEDKRARTRSKALRGPPETTAADLSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALDEGYGVDSDGSEDTEVKDASVSDESEGTLEGAEAETSGQDEIHRPETAE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MYT1 myelin transcription factor 1 [ Homo sapiens ] |
Official Symbol | MYT1 |
Synonyms | MYT1; myelin transcription factor 1; PLPB1; MTF1; MYTI; myelin transcription factor I; proteolipid protein binding protein; proteolipid protein-binding protein; C20orf36; |
Gene ID | 4661 |
mRNA Refseq | NM_004535 |
Protein Refseq | NP_004526 |
MIM | 600379 |
UniProt ID | Q01538 |
◆ Recombinant Proteins | ||
MYT1-5868H | Recombinant Human MYT1 Protein, GST-tagged | +Inquiry |
Myt1-7971M | Recombinant Mouse Myt1 protein, His & T7-tagged | +Inquiry |
MYT1-3004H | Recombinant Human MYT1 Protein, GST-tagged | +Inquiry |
MYT1-3006H | Recombinant Human MYT1 Protein, His-tagged | +Inquiry |
MYT1-4657H | Recombinant Human MYT1 Protein (His903-Val1121), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYT1-1163HCL | Recombinant Human MYT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYT1 Products
Required fields are marked with *
My Review for All MYT1 Products
Required fields are marked with *