Recombinant Human MYT1 protein, His-tagged
| Cat.No. : | MYT1-3002H |
| Product Overview : | Recombinant Human MYT1 protein(1-132 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 08, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-132 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSLENEDKRARTRSKALRGPPETTAADLSCPTPGCTGSGHVRGKYSRHRSLQSCPLAKKRKLEGAEAEHLVSKRKSHPLKLALDEGYGVDSDGSEDTEVKDASVSDESEGTLEGAEAETSGQDEIHRPETAE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MYT1 myelin transcription factor 1 [ Homo sapiens ] |
| Official Symbol | MYT1 |
| Synonyms | MYT1; myelin transcription factor 1; PLPB1; MTF1; MYTI; myelin transcription factor I; proteolipid protein binding protein; proteolipid protein-binding protein; C20orf36; |
| Gene ID | 4661 |
| mRNA Refseq | NM_004535 |
| Protein Refseq | NP_004526 |
| MIM | 600379 |
| UniProt ID | Q01538 |
| ◆ Recombinant Proteins | ||
| MYT1-3002H | Recombinant Human MYT1 protein, His-tagged | +Inquiry |
| MYT1-1156H | Recombinant Human MYT1, His-tagged | +Inquiry |
| Myt1-7971M | Recombinant Mouse Myt1 protein, His & T7-tagged | +Inquiry |
| MYT1-3006H | Recombinant Human MYT1 Protein, His-tagged | +Inquiry |
| MYT1-1288H | Recombinant Human MYT1 Protein (900-1101 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MYT1-1163HCL | Recombinant Human MYT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYT1 Products
Required fields are marked with *
My Review for All MYT1 Products
Required fields are marked with *
