Recombinant Human NANOG Protein

Cat.No. : NANOG-14H
Product Overview : Recombinant human NANOG-TAT (rhNANOG-TAT) produced in E. coli is a single chain, 318 amino acids non-glycosylated polypeptide. A fully biologically active molecule, rhNANOG-TAT has a molecular mass of 36.2kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Molecular Mass : 36.2 kDa, analyzed by reducing SDS-PAGE.
AA Sequence : MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVGGYGRKKRRQRRR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Recombinant human NANOG-TAT (rhNANOG-TAT) remains stable up to 1-2 weeks at 4 centigrade from date of receipt. For long term storage, aliquot and store at -20 or -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : Sterile Filtered solution contains 10mM PB, 300mM NaCl, pH7.4.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name NANOG Nanog homeobox [ Homo sapiens (human) ]
Official Symbol NANOG
Synonyms NANOG; Nanog homeobox; homeobox protein NANOG; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48
Gene ID 79923
mRNA Refseq NM_024865
Protein Refseq NP_079141
MIM 607937
UniProt ID Q9H9S0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NANOG Products

Required fields are marked with *

My Review for All NANOG Products

Required fields are marked with *

0
cart-icon