Recombinant Human NANOG Protein, His-tagged
Cat.No. : | NANOG-144H |
Product Overview : | Recombinant Human NANOG Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Nanog is a homeodomain-containing transcription factor that is essential for the maintenance of pluripotency and self renewal in embryonic stem cells. Nanog expression is controlled by a network of factors including Sox2 and the key pluripotency regulator Oct-4. Recent advances in somatic cell reprogramming have utilized viral expression of combinations of transcription factors including nanog, Oct-4, Sox2, KLF4, c-Myc, and LIN28. |
Molecular Mass : | ~40 kDa |
AA Sequence : | HMSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVLE |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | 0.5M Urea, pH7.4 |
Gene Name | NANOG Nanog homeobox [ Homo sapiens (human) ] |
Official Symbol | NANOG |
Synonyms | NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48; |
Gene ID | 79923 |
mRNA Refseq | NM_024865 |
Protein Refseq | NP_079141 |
MIM | 607937 |
UniProt ID | Q9H9S0 |
◆ Recombinant Proteins | ||
NANOG-5682Z | Recombinant Zebrafish NANOG | +Inquiry |
NANOG-470C | Recombinant Cynomolgus Monkey NANOG Protein, His (Fc)-Avi-tagged | +Inquiry |
NANOG-144H | Recombinant Human NANOG Protein, His-tagged | +Inquiry |
NANOG-5188H | Recombinant Human NANOG Protein (Trp153-Val305), N-His tagged | +Inquiry |
Nanog-151M | Recombinant Mouse Nanog, TAT-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NANOG-3981HCL | Recombinant Human NANOG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NANOG Products
Required fields are marked with *
My Review for All NANOG Products
Required fields are marked with *