Recombinant Human NANOG Protein, His-tagged

Cat.No. : NANOG-144H
Product Overview : Recombinant Human NANOG Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Nanog is a homeodomain-containing transcription factor that is essential for the maintenance of pluripotency and self renewal in embryonic stem cells. Nanog expression is controlled by a network of factors including Sox2 and the key pluripotency regulator Oct-4. Recent advances in somatic cell reprogramming have utilized viral expression of combinations of transcription factors including nanog, Oct-4, Sox2, KLF4, c-Myc, and LIN28.
Molecular Mass : ~40 kDa
AA Sequence : HMSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDVLE
Purity : Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : 0.5M Urea, pH7.4
Gene Name NANOG Nanog homeobox [ Homo sapiens (human) ]
Official Symbol NANOG
Synonyms NANOG; Nanog homeobox; homeobox protein NANOG; FLJ12581; FLJ40451; hNanog; homeobox transcription factor Nanog; homeobox transcription factor Nanog-delta 48;
Gene ID 79923
mRNA Refseq NM_024865
Protein Refseq NP_079141
MIM 607937
UniProt ID Q9H9S0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NANOG Products

Required fields are marked with *

My Review for All NANOG Products

Required fields are marked with *

0
cart-icon
0
compare icon