Recombinant Human NCF2 protein, GST-tagged
Cat.No. : | NCF2-4544H |
Product Overview : | Recombinant Human NCF2 protein(1-345 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-345 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MSLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAAEPPPRPKTPEIFRALEGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVELRIHPQQQPQEESSPQSDIPAPPSSKAPGRPQLSPGQKQKEEPKEVK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | NCF2 |
Synonyms | NCF2; neutrophil cytosolic factor 2; neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal 2); neutrophil cytosol factor 2; chronic granulomatous disease; autosomal 2; NADPH oxidase activator 2; NOXA2; p67phox; 67 kDa neutrophil oxidase factor; neutrophil NADPH oxidase factor 2; chronic granulomatous disease, autosomal 2; NCF-2; P67PHOX; P67-PHOX; FLJ93058; |
Gene ID | 4688 |
mRNA Refseq | NM_000433 |
Protein Refseq | NP_000424 |
MIM | 608515 |
UniProt ID | P19878 |
◆ Recombinant Proteins | ||
NCF2-4668H | Recombinant Human NCF2 Protein (Lys355-Val526), His tagged | +Inquiry |
NCF2-573HFL | Recombinant Full Length Human NCF2 Protein, C-Flag-tagged | +Inquiry |
NCF2-1984H | Recombinant Human NCF2 protein | +Inquiry |
NCF2-3578R | Recombinant Rat NCF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCF2-400H | Recombinant Human NCF2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCF2-001HCL | Recombinant Human NCF2 cell lysate | +Inquiry |
NCF2-005HCL | Recombinant Human NCF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCF2 Products
Required fields are marked with *
My Review for All NCF2 Products
Required fields are marked with *
0
Inquiry Basket