Recombinant Human NCOA4 Protein, GST-tagged

• Cat.No.: NCOA4-1215H
• Product Overview: Recombinant Human NCOA4 Protein(1-400 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-400 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKV
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: NCOA4
• Synonyms: NCOA4; nuclear receptor coactivator 4; ARA70; DKFZp762E1112; ELE1; PTC3; RET activating gene ELE1; RFG; NCoA-4; ret fused; 70 kDa AR-activator; RET-activating gene ELE1; 70 kDa androgen receptor coactivator; androgen receptor-associated protein of 70 kDa
• Gene ID: 8031
• mRNA Refseq: NM_001145260
• Protein Refseq: NP_001138732
• MIM: 601984
• UniProt ID: Q13772