Recombinant Human NCOA4 Protein, GST-tagged
Cat.No. : | NCOA4-1215H |
Product Overview : | Recombinant Human NCOA4 Protein(1-400 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-400 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKV |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | NCOA4 |
Synonyms | NCOA4; nuclear receptor coactivator 4; ARA70; DKFZp762E1112; ELE1; PTC3; RET activating gene ELE1; RFG; NCoA-4; ret fused; 70 kDa AR-activator; RET-activating gene ELE1; 70 kDa androgen receptor coactivator; androgen receptor-associated protein of 70 kDa; |
Gene ID | 8031 |
mRNA Refseq | NM_001145260 |
Protein Refseq | NP_001138732 |
MIM | 601984 |
UniProt ID | Q13772 |
◆ Recombinant Proteins | ||
NCOA4-1214H | Recombinant Human NCOA4 protein, His-tagged | +Inquiry |
NCOA4-1634C | Recombinant Chicken NCOA4 | +Inquiry |
NCOA4-1215H | Recombinant Human NCOA4 Protein, GST-tagged | +Inquiry |
Ncoa4-4315M | Recombinant Mouse Ncoa4 Protein, Myc/DDK-tagged | +Inquiry |
NCOA4-7854H | Recombinant Human NCOA4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCOA4-3940HCL | Recombinant Human NCOA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCOA4 Products
Required fields are marked with *
My Review for All NCOA4 Products
Required fields are marked with *
0
Inquiry Basket