Recombinant Human NCOA4 protein, GST-tagged

Cat.No. : NCOA4-7854H
Product Overview : Recombinant Human NCOA4 protein(1-400 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-400 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKV
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol NCOA4
Synonyms NCOA4; nuclear receptor coactivator 4; ARA70; DKFZp762E1112; ELE1; PTC3; RET activating gene ELE1; RFG; NCoA-4; ret fused; 70 kDa AR-activator; RET-activating gene ELE1; 70 kDa androgen receptor coactivator; androgen receptor-associated protein of 70 kDa;
Gene ID 8031
mRNA Refseq NM_001145260
Protein Refseq NP_001138732
MIM 601984
UniProt ID Q13772

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCOA4 Products

Required fields are marked with *

My Review for All NCOA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon