Recombinant Human NCR1 protein, T7/His-tagged
| Cat.No. : | NCR1-87H | 
| Product Overview : | Recombinant human CD335 extracellular domain cDNA (22-258 aa, Isoform-a) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Protein Length : | 22-258 a.a. | 
| Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGEFQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFA VDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFY CRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTS LAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR | 
| Purity : | >90% by SDS-PAGE | 
| Applications : | 1. May be used for in vitro CD335 mediated NK cell activation regulatory study with this protein as either soluble factor or coating matrix.2. May be used for CD335 protein-protein interaction assay.3. Potential biomarker for Sezary syndrome diagnosis when combined with PLS3, Twist, KIR3DL2 protein detection.4. May be used for specific antibody production. | 
| Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. | 
| Gene Name | NCR1 natural cytotoxicity triggering receptor 1 [ Homo sapiens ] | 
| Official Symbol | NCR1 | 
| Synonyms | NCR1; natural cytotoxicity triggering receptor 1; LY94, lymphocyte antigen 94 (mouse) homolog (activating NK receptor; NK p46); CD335; NK p46; NKP46; NK cell-activating receptor; natural killer cell p46-related protein; lymphocyte antigen 94 homolog (act | 
| Gene ID | 9437 | 
| mRNA Refseq | NM_001145457 | 
| Protein Refseq | NP_001138929 | 
| MIM | 604530 | 
| UniProt ID | O76036 | 
| Chromosome Location | 19 | 
| Pathway | Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; | 
| Function | receptor activity; receptor signaling protein activity; | 
| ◆ Recombinant Proteins | ||
| NCR1-2779R | Recombinant Rhesus Macaque NCR1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| NCR1-0525H | Active Recombinant Human NCR1 protein, lFc-tagged | +Inquiry | 
| NCR1-3582R | Recombinant Rat NCR1 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| NCR1-1756R | Recombinant Rhesus Monkey NCR1 Protein, hIgG1-tagged | +Inquiry | 
| NCR1-4532H | Recombinant Human NCR1 protein, hFc-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| NCR1-1244RCL | Recombinant Rat NCR1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCR1 Products
Required fields are marked with *
My Review for All NCR1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            