Recombinant Human NCR1 protein, T7/His-tagged
Cat.No. : | NCR1-87H |
Product Overview : | Recombinant human CD335 extracellular domain cDNA (22-258 aa, Isoform-a) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 22-258 a.a. |
Form : | 0.50 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGEFQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFA VDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFY CRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTS LAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro CD335 mediated NK cell activation regulatory study with this protein as either soluble factor or coating matrix.2. May be used for CD335 protein-protein interaction assay.3. Potential biomarker for Sezary syndrome diagnosis when combined with PLS3, Twist, KIR3DL2 protein detection.4. May be used for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | NCR1 natural cytotoxicity triggering receptor 1 [ Homo sapiens ] |
Official Symbol | NCR1 |
Synonyms | NCR1; natural cytotoxicity triggering receptor 1; LY94, lymphocyte antigen 94 (mouse) homolog (activating NK receptor; NK p46); CD335; NK p46; NKP46; NK cell-activating receptor; natural killer cell p46-related protein; lymphocyte antigen 94 homolog (act |
Gene ID | 9437 |
mRNA Refseq | NM_001145457 |
Protein Refseq | NP_001138929 |
MIM | 604530 |
UniProt ID | O76036 |
Chromosome Location | 19 |
Pathway | Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
Function | receptor activity; receptor signaling protein activity; |
◆ Recombinant Proteins | ||
NCR1-0522C | Active Recombinant Cynomolgus NCR1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
NCR1-0523C | Active Recombinant Cynomolgus NCR1 protein, His-tagged | +Inquiry |
NCR1-0525H | Active Recombinant Human NCR1 protein, lFc-tagged | +Inquiry |
NCR1-204H | Recombinant Human NCR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCR1-400H | Recombinant Human NCR1 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCR1-1244RCL | Recombinant Rat NCR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCR1 Products
Required fields are marked with *
My Review for All NCR1 Products
Required fields are marked with *
0
Inquiry Basket