Recombinant Human NCR3 Protein, Fc-tagged
Cat.No. : | NCR3-399H |
Product Overview : | Recombinant human NCR3 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 201 |
Description : | The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 39.5 kDa |
AA Sequence : | MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVLLLRAGFYAVSFLSVAVGSTVYYQGKCLTWKGPRRQLPAVVPAPLPPPCGSSAHLLPPVPGG |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | NCR3 natural cytotoxicity triggering receptor 3 [ Homo sapiens (human) ] |
Official Symbol | NCR3 |
Synonyms | NCR3; natural cytotoxicity triggering receptor 3; LY117, lymphocyte antigen 117; 1C7; CD337; NKp30; NK-p30; lymphocyte antigen 117; activating NK-A1 receptor; activating natural killer receptor p30; natural killer cell p30-related protein; MALS; LY117; |
Gene ID | 259197 |
mRNA Refseq | NM_001145466 |
Protein Refseq | NP_001138938 |
MIM | 611550 |
UniProt ID | O14931 |
◆ Recombinant Proteins | ||
NCR3-197H | Recombinant Human NCR3 protein, His-Avi-tagged, Biotinylated | +Inquiry |
NCR3-4180H | Recombinant Human NCR3 Protein (Met1-Gly135), C-His tagged | +Inquiry |
NCR3-2693H | Active Recombinant Human NCR3 protein, hFc&His-tagged | +Inquiry |
NCR3-498C | Active Recombinant Cynomolgus NCR3 Protein, His-tagged | +Inquiry |
NCR3-785H | Recombinant Human NCR3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCR3-2652HCL | Recombinant Human NCR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NCR3 Products
Required fields are marked with *
My Review for All NCR3 Products
Required fields are marked with *
0
Inquiry Basket