Recombinant Human NEK1 protein, His-tagged

Cat.No. : NEK1-3124H
Product Overview : Recombinant Human NEK1 protein(557-740 aa), fused to His tag, was expressed in E. coli.
Availability February 04, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 557-740 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : KRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTD
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NEK1 NIMA (never in mitosis gene a)-related kinase 1 [ Homo sapiens ]
Official Symbol NEK1
Synonyms NEK1; NIMA (never in mitosis gene a)-related kinase 1; serine/threonine-protein kinase Nek1; KIAA1901; NY REN 55; nimA-related protein kinase 1; protein-serine/threonine kinase; renal carcinoma antigen NY-REN-55; never in mitosis A-related kinase 1; SRPS2; NY-REN-55; MGC138800; DKFZp686D06121; DKFZp686K12169;
Gene ID 4750
mRNA Refseq NM_001199397
Protein Refseq NP_001186326
MIM 604588
UniProt ID Q96PY6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NEK1 Products

Required fields are marked with *

My Review for All NEK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon