Recombinant Human NEU4 protein, GST-tagged
| Cat.No. : | NEU4-301537H |
| Product Overview : | Recombinant Human NEU4 (158-496 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ala158-Ser496 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | AIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | NEU4 sialidase 4 [ Homo sapiens ] |
| Official Symbol | NEU4 |
| Synonyms | NEU4; sialidase 4; sialidase-4; neuraminidase 4; N-acetyl-alpha-neuraminidase 4; FLJ35928; MGC18222; MGC102757; |
| Gene ID | 129807 |
| mRNA Refseq | NM_001167599 |
| Protein Refseq | NP_001161071 |
| MIM | 608527 |
| UniProt ID | Q8WWR8 |
| ◆ Recombinant Proteins | ||
| NEU4-2737Z | Recombinant Zebrafish NEU4 | +Inquiry |
| NEU4-2058H | Recombinant Human NEU4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Neu4-4381M | Recombinant Mouse Neu4 Protein, Myc/DDK-tagged | +Inquiry |
| Neu4-2442M | Recombinant Mouse Neu4 protein, His-tagged | +Inquiry |
| Neu4-1134M | Recombinant Mouse Neu4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NEU4-3869HCL | Recombinant Human NEU4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU4 Products
Required fields are marked with *
My Review for All NEU4 Products
Required fields are marked with *



