Recombinant Human NEU4 protein, GST-tagged
Cat.No. : | NEU4-301537H |
Product Overview : | Recombinant Human NEU4 (158-496 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala158-Ser496 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCNARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGPGSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSWTLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYSDLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGCCWPS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | NEU4 sialidase 4 [ Homo sapiens ] |
Official Symbol | NEU4 |
Synonyms | NEU4; sialidase 4; sialidase-4; neuraminidase 4; N-acetyl-alpha-neuraminidase 4; FLJ35928; MGC18222; MGC102757; |
Gene ID | 129807 |
mRNA Refseq | NM_001167599 |
Protein Refseq | NP_001161071 |
MIM | 608527 |
UniProt ID | Q8WWR8 |
◆ Recombinant Proteins | ||
NEU4-1504H | Recombinant Human NEU4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NEU4-6019M | Recombinant Mouse NEU4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL32338MF | Recombinant Full Length Mouse Sialidase-4(Neu4) Protein, His-Tagged | +Inquiry |
NEU4-4014H | Recombinant Human NEU4 Protein (Tyr22-Pro286), N-His tagged | +Inquiry |
NEU4-129HFL | Active Recombinant Full Length Human NEU4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU4-3869HCL | Recombinant Human NEU4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NEU4 Products
Required fields are marked with *
My Review for All NEU4 Products
Required fields are marked with *