Recombinant Mouse Neu4 protein, His-tagged
Cat.No. : | Neu4-2442M |
Product Overview : | Recombinant Mouse Neu4 protein(Q8BZL1)(1-478aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-478aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.5 kDa |
AA Sequence : | MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Neu4 sialidase 4 [ Mus musculus ] |
Official Symbol | Neu4 |
Synonyms | NEU4; sialidase 4; sialidase-4; neuraminidase 4; N-acetyl-alpha-neuraminidase 4; 9330166I04; |
Gene ID | 241159 |
mRNA Refseq | NM_173772 |
Protein Refseq | NP_776133 |
◆ Recombinant Proteins | ||
Neu4-4381M | Recombinant Mouse Neu4 Protein, Myc/DDK-tagged | +Inquiry |
Neu4-1134M | Recombinant Mouse Neu4 protein, GST-tagged | +Inquiry |
Neu4-2442M | Recombinant Mouse Neu4 protein, His-tagged | +Inquiry |
NEU4-301537H | Recombinant Human NEU4 protein, GST-tagged | +Inquiry |
NEU4-4014H | Recombinant Human NEU4 Protein (Tyr22-Pro286), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEU4-3869HCL | Recombinant Human NEU4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Neu4 Products
Required fields are marked with *
My Review for All Neu4 Products
Required fields are marked with *
0
Inquiry Basket