Recombinant Human NFE2L2

Cat.No. : NFE2L2-30414TH
Product Overview : Recombinant fragment corresponding to amino acids 71-170 of Human Nrf2 with a N terminal proprietary tag, Predicted MWt 36.63 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA
Sequence Similarities : Belongs to the bZIP family. CNC subfamily.Contains 1 bZIP domain.
Gene Name NFE2L2 nuclear factor (erythroid-derived 2)-like 2 [ Homo sapiens ]
Official Symbol NFE2L2
Synonyms NFE2L2; nuclear factor (erythroid-derived 2)-like 2; nuclear factor erythroid 2-related factor 2; NF E2 related factor 2; NRF2;
Gene ID 4780
mRNA Refseq NM_001145412
Protein Refseq NP_001138884
MIM 600492
Uniprot ID Q16236
Chromosome Location 2q31
Pathway Keap1-Nrf2 Pathway, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem;
Function protein dimerization activity; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFE2L2 Products

Required fields are marked with *

My Review for All NFE2L2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon