Recombinant Human NFE2L2
Cat.No. : | NFE2L2-30414TH |
Product Overview : | Recombinant fragment corresponding to amino acids 71-170 of Human Nrf2 with a N terminal proprietary tag, Predicted MWt 36.63 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | NFE2 (MIM 601490), NFE2L1 (MIM 163260), and NFE2L2 comprise a family of human genes encoding basic leucine zipper (bZIP) transcription factors. They share highly conserved regions that are distinct from other bZIP families, such as JUN (MIM 165160) and FOS (MIM 164810), although remaining regions have diverged considerably from each other (Chan et al. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Widely expressed. Highest expression in adult muscle, kidney, lung, liver and in fetal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA |
Sequence Similarities : | Belongs to the bZIP family. CNC subfamily.Contains 1 bZIP domain. |
Gene Name | NFE2L2 nuclear factor (erythroid-derived 2)-like 2 [ Homo sapiens ] |
Official Symbol | NFE2L2 |
Synonyms | NFE2L2; nuclear factor (erythroid-derived 2)-like 2; nuclear factor erythroid 2-related factor 2; NF E2 related factor 2; NRF2; |
Gene ID | 4780 |
mRNA Refseq | NM_001145412 |
Protein Refseq | NP_001138884 |
MIM | 600492 |
Uniprot ID | Q16236 |
Chromosome Location | 2q31 |
Pathway | Keap1-Nrf2 Pathway, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; |
Function | protein dimerization activity; protein domain specific binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
NFE2L2-10615M | Recombinant Mouse NFE2L2 Protein | +Inquiry |
NFE2L2-30414TH | Recombinant Human NFE2L2 | +Inquiry |
NFE2L2-3631R | Recombinant Rat NFE2L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NFE2L2-8469H | Recombinant Human NFE2L2, His-tagged | +Inquiry |
NFE2L2-1917H | Recombinant Human NFE2L2 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFE2L2-3854HCL | Recombinant Human NFE2L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NFE2L2 Products
Required fields are marked with *
My Review for All NFE2L2 Products
Required fields are marked with *