Recombinant Human NFKB1 protein, GST-tagged

Cat.No. : NFKB1-3742H
Product Overview : Recombinant Human NFKB1 protein(1-368 aa), fused to GST tag, was expressed in E. coli.
Availability December 25, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-368 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLM
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name NFKB1 nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 [ Homo sapiens ]
Official Symbol NFKB1
Synonyms NFKB1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor NF-kappa-B p105 subunit; KBF1; NF kappaB; NF kB1; NFkappaB; NFKB p50; p50; p105; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit; EBP-1; NF-kB1; NFKB-p50; NF-kappaB; NFKB-p105; NF-kappa-B; MGC54151; DKFZp686C01211;
Gene ID 4790
mRNA Refseq NM_001165412
Protein Refseq NP_001158884
MIM 164011
UniProt ID P19838

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NFKB1 Products

Required fields are marked with *

My Review for All NFKB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon