Recombinant Human NIPSNAP3A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | NIPSNAP3A-2422H |
Product Overview : | NIPSNAP3A MS Standard C13 and N15-labeled recombinant protein (NP_056284) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport. |
Molecular Mass : | 28.5 kDa |
AA Sequence : | MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NIPSNAP3A nipsnap homolog 3A [ Homo sapiens (human) ] |
Official Symbol | NIPSNAP3A |
Synonyms | NIPSNAP3A; nipsnap homolog 3A (C. elegans); protein NipSnap homolog 3A; DKFZp564D177; FLJ13953; HSPC299; MGC14553; protein NipSnap homolog 4; target for Salmonella secreted protein C; TASSC; NIPSNAP4; |
Gene ID | 25934 |
mRNA Refseq | NM_015469 |
Protein Refseq | NP_056284 |
MIM | 608871 |
UniProt ID | Q9UFN0 |
◆ Recombinant Proteins | ||
NIPSNAP3A-10602Z | Recombinant Zebrafish NIPSNAP3A | +Inquiry |
NIPSNAP3A-5877H | Recombinant Human NIPSNAP3A Protein, His-tagged | +Inquiry |
NIPSNAP3A-5876H | Recombinant Human NIPSNAP3A Protein, GST-tagged | +Inquiry |
NIPSNAP3A-6637HF | Recombinant Full Length Human NIPSNAP3A Protein, GST-tagged | +Inquiry |
NIPSNAP3A-1512H | Recombinant Human NIPSNAP3A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIPSNAP3A-3826HCL | Recombinant Human NIPSNAP3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NIPSNAP3A Products
Required fields are marked with *
My Review for All NIPSNAP3A Products
Required fields are marked with *
0
Inquiry Basket