Recombinant Human NIPSNAP3A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: NIPSNAP3A-2422H
• Product Overview: NIPSNAP3A MS Standard C13 and N15-labeled recombinant protein (NP_056284) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: NIPSNAP3A belongs to a family of proteins with putative roles in vesicular transport.
• Molecular Mass: 28.5 kDa
• AA Sequence: MLVLRSALTRALASRTLAPQMCSSFATGPRQYDGIFYEFRSYYLKPSKMNEFLENFEKNAHLRTAHSELVGYWSVEFGGRMNTVFHIWKYDNFAHRTEVRKALAKDKEWQEQFLIPNLALIDKQESEITYLVPWCKLEKPPKEGVYELATFQMKPGGPALWGDAFKRAVHAHVNLGYTKLVGVFHTEYGALNRVHVLWWNESADSRAAGRHKSHEDPRVVAAVRESVNYLVSQQNMLLIPTSFSPLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: NIPSNAP3A nipsnap homolog 3A [ Homo sapiens (human) ]
• Official Symbol: NIPSNAP3A
• Synonyms: NIPSNAP3A; nipsnap homolog 3A (C. elegans); protein NipSnap homolog 3A; DKFZp564D177; FLJ13953; HSPC299; MGC14553; protein NipSnap homolog 4; target for Salmonella secreted protein C; TASSC; NIPSNAP4
• Gene ID: 25934
• mRNA Refseq: NM_015469
• Protein Refseq: NP_056284
• MIM: 608871
• UniProt ID: Q9UFN0