Recombinant Human Nkx3-2 Protein, His/MYC-tagged
| Cat.No. : | Nkx3-2-1295H |
| Product Overview : | Recombinant Human Nkx3-2 Protein (143-800aa) was expressed in E. coli with N-terminal His/MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 53.7 kDa/40.2 kDa/35.2 kDa |
| AA Sequence : | MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | NKX3-2 NK3 homeobox 2 [ Homo sapiens ] |
| Official Symbol | Nkx3-2 |
| Synonyms | Nkx3-2; SMMD; BAPX1; NKX3B; NKX3.2 |
| Gene ID | 579 |
| mRNA Refseq | NM_001189.3 |
| Protein Refseq | NP_001180.1 |
| MIM | 602183 |
| UniProt ID | P78367 |
| ◆ Recombinant Proteins | ||
| Nkx3-2-3278M | Recombinant Mouse Nkx3-2 protein | +Inquiry |
| NKX3-2-3038R | Recombinant Rhesus monkey NKX3-2 Protein, His-tagged | +Inquiry |
| Nkx3-2-1295H | Recombinant Human Nkx3-2 Protein, His/MYC-tagged | +Inquiry |
| NKX3-2-580H | Recombinant Human NKX3-2 | +Inquiry |
| NKX3-2-215H | Recombinant Human NKX3-2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Nkx3-2 Products
Required fields are marked with *
My Review for All Nkx3-2 Products
Required fields are marked with *
