Recombinant Human NLGN4X Protein, GST-tagged
Cat.No. : | NLGN4X-5913H |
Product Overview : | Human NLGN4X partial ORF ( NP_065793, 577 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NLGN4X neuroligin 4, X-linked [ Homo sapiens ] |
Official Symbol | NLGN4X |
Synonyms | NLGN4X; neuroligin 4, X-linked; neuroligin 4 , NLGN4; neuroligin-4, X-linked; HLNX; KIAA1260; NLGN; neuroligin X; HNLX; HNL4X; NLGN4; ASPGX2; AUTSX2; MGC22376; |
Gene ID | 57502 |
mRNA Refseq | NM_020742 |
Protein Refseq | NP_065793 |
MIM | 300427 |
UniProt ID | Q8N0W4 |
◆ Recombinant Proteins | ||
NLGN4X-2491H | Recombinant Human NLGN4X Protein, His-tagged | +Inquiry |
NLGN4X-158H | Recombinant Human NLGN4X, His-tagged | +Inquiry |
NLGN4X-394H | Recombinant Human NLGN4X Protein, His-tagged | +Inquiry |
NLGN4X-731H | Active Recombinant Human NLGN4X Protein, His-tagged | +Inquiry |
NLGN4X-5849H | Recombinant Human NLGN4X Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLGN4X-3808HCL | Recombinant Human NLGN4X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NLGN4X Products
Required fields are marked with *
My Review for All NLGN4X Products
Required fields are marked with *