Recombinant Human NLGN4X Protein, GST-tagged

Cat.No. : NLGN4X-5913H
Product Overview : Human NLGN4X partial ORF ( NP_065793, 577 a.a. - 676 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : RVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NLGN4X neuroligin 4, X-linked [ Homo sapiens ]
Official Symbol NLGN4X
Synonyms NLGN4X; neuroligin 4, X-linked; neuroligin 4 , NLGN4; neuroligin-4, X-linked; HLNX; KIAA1260; NLGN; neuroligin X; HNLX; HNL4X; NLGN4; ASPGX2; AUTSX2; MGC22376;
Gene ID 57502
mRNA Refseq NM_020742
Protein Refseq NP_065793
MIM 300427
UniProt ID Q8N0W4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NLGN4X Products

Required fields are marked with *

My Review for All NLGN4X Products

Required fields are marked with *

0
cart-icon