Recombinant Human NLRP3 protein, His-SUMO-tagged
Cat.No. : | NLRP3-3003H |
Product Overview : | Recombinant Human NLRP3 protein(Q96P20)(733-1036aa), fused with N-terminal His-SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 733-1036aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 45.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW |
Gene Name | NLRP3 NLR family, pyrin domain containing 3 [ Homo sapiens ] |
Official Symbol | NLRP3 |
Synonyms | NLRP3; NLR family, pyrin domain containing 3; C1orf7, CIAS1, cold autoinflammatory syndrome 1; NACHT, LRR and PYD domains-containing protein 3; AGTAVPRL; AII; AVP; CLR1.1; Cryopyrin; FCAS; FCU; MWS; NALP3; nucleotide binding oligomerization domain; leucine rich repeat and pyrin domain containing 3; PYPAF1; cryopyrin; caterpiller protein 1.1; PYRIN-containing APAF1-like protein 1; NACHT, LRR and PYD containing protein 3; cold autoinflammatory syndrome 1 protein; NACHT domain-, leucine-rich repeat-, and PYD-containing protein 3; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 3; CIAS1; C1orf7; FLJ95925; |
Gene ID | 114548 |
mRNA Refseq | NM_001079821 |
Protein Refseq | NP_001073289 |
MIM | 606416 |
UniProt ID | Q96P20 |
◆ Recombinant Proteins | ||
Nlrp3-4651M | Recombinant Mouse Nlrp3 protein, His-SUMO-tagged | +Inquiry |
NLRP3-569HFL | Recombinant Full Length Human NLRP3 Protein, C-Flag-tagged | +Inquiry |
NLRP3-3003H | Recombinant Human NLRP3 protein, His-SUMO-tagged | +Inquiry |
NLRP3-1518H | Recombinant Human NLRP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Nlrp3-1748M | Recombinant Mouse Nlrp3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLRP3-3799HCL | Recombinant Human NLRP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NLRP3 Products
Required fields are marked with *
My Review for All NLRP3 Products
Required fields are marked with *
0
Inquiry Basket