Recombinant Human NME6 protein, His-tagged
Cat.No. : | NME6-3314H |
Product Overview : | Recombinant Human NME6 protein(1-194 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-194 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens ] |
Official Symbol | NME6 |
Synonyms | NME6; non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 6; IPIA ALPHA; NM23 H6; NDP kinase 6; inhibitor of p53-induced apoptosis-alpha; NDK 6; NM23-H6; IPIA-ALPHA; |
Gene ID | 10201 |
mRNA Refseq | NM_005793 |
Protein Refseq | NP_005784 |
MIM | 608294 |
UniProt ID | O75414 |
◆ Recombinant Proteins | ||
NME6-5934H | Recombinant Human NME6 Protein, GST-tagged | +Inquiry |
Nme6-1458R | Recombinant Rat Nme6 protein, His & T7-tagged | +Inquiry |
NME6-1456H | Recombinant Human NME6 protein, His & T7-tagged | +Inquiry |
Nme6-4439M | Recombinant Mouse Nme6 Protein, Myc/DDK-tagged | +Inquiry |
NME6-749C | Recombinant Cynomolgus NME6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME6-3787HCL | Recombinant Human NME6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NME6 Products
Required fields are marked with *
My Review for All NME6 Products
Required fields are marked with *
0
Inquiry Basket