Recombinant Human NME6 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | NME6-207H |
Product Overview : | NME6 MS Standard C13 and N15-labeled recombinant protein (NP_005784) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Nucleoside diphosphate (NDP) kinases (EC 2.7.4.6), such as NME6, are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates (Mehus et al., 1999 [PubMed 10453732]). [supplied by OMIM, Jul 2010] |
Molecular Mass : | 22 kDa |
AA Sequence : | MTQNLGSEMASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | NME6 non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase) [ Homo sapiens (human) ] |
Official Symbol | NME6 |
Synonyms | NME6; non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase); nucleoside diphosphate kinase 6; IPIA ALPHA; NM23 H6; NDP kinase 6; inhibitor of p53-induced apoptosis-alpha; NDK 6; NM23-H6; IPIA-ALPHA; |
Gene ID | 10201 |
mRNA Refseq | NM_005793 |
Protein Refseq | NP_005784 |
MIM | 608294 |
UniProt ID | O75414 |
◆ Recombinant Proteins | ||
Nme6-1457M | Recombinant Mouse Nme6 protein, His-tagged | +Inquiry |
NME6-3314H | Recombinant Human NME6 protein, His-tagged | +Inquiry |
Nme6-1458R | Recombinant Rat Nme6 protein, His & T7-tagged | +Inquiry |
NME6-10743M | Recombinant Mouse NME6 Protein | +Inquiry |
NME6-5934H | Recombinant Human NME6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NME6-3787HCL | Recombinant Human NME6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NME6 Products
Required fields are marked with *
My Review for All NME6 Products
Required fields are marked with *