Recombinant Human NOMO2 Protein, GST-tagged
Cat.No. : | NOMO2-5984H |
Product Overview : | Human NOMO2 partial ORF ( NP_775885.1, 1040 a.a. - 1139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). Two transcripts encoding different isoforms have been described. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | NNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOMO2 NODAL modulator 2 [ Homo sapiens (human) ] |
Official Symbol | NOMO2 |
Synonyms | NOMO2; PM5; Nomo; NODAL modulator 2; nodal modulator 2; pM5 protein 2; pM5 protein, centromeric copy |
Gene ID | 283820 |
mRNA Refseq | NM_001004060 |
Protein Refseq | NP_001004060 |
MIM | 609158 |
UniProt ID | Q5JPE7 |
◆ Recombinant Proteins | ||
NOMO2-5984H | Recombinant Human NOMO2 Protein, GST-tagged | +Inquiry |
NOMO2-3878H | Recombinant Human NOMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
NOMO2-3404H | Recombinant Human NOMO2 protein, His-tagged | +Inquiry |
NOMO2-1162H | Recombinant Human NOMO2 Protein, MYC/DDK-tagged | +Inquiry |
NOMO2-1331H | Recombinant Human NOMO2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOMO2 Products
Required fields are marked with *
My Review for All NOMO2 Products
Required fields are marked with *
0
Inquiry Basket